Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 2.1 1.8e+03 -0.9 0.1 27 39 77 89 73 96 0.80

2 6 0.00046 0.38 10.8 0.0 21 47 116 142 108 149 0.86

3 6 0.91 7.5e+02 0.3 0.1 21 44 144 167 140 172 0.79

4 6 6.5e-05 0.054 13.5 0.1 20 47 171 198 154 205 0.81

5 6 1.5 1.2e+03 -0.4 0.1 21 44 200 223 196 227 0.72

6 6 0.0013 1.1 9.3 0.0 21 44 228 251 210 252 0.88

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	2.1	1.8e+03	-0.9	0.1	27	39	77	89	73	96	0.80
2	6	0.00046	0.38	10.8	0.0	21	47	116	142	108	149	0.86
3	6	0.91	7.5e+02	0.3	0.1	21	44	144	167	140	172	0.79
4	6	6.5e-05	0.054	13.5	0.1	20	47	171	198	154	205	0.81
5	6	1.5	1.2e+03	-0.4	0.1	21	44	200	223	196	227	0.72
6	6	0.0013	1.1	9.3	0.0	21	44	228	251	210	252	0.88

Coding Sequence: ATGAAGcggtggtgtggtggcggtggatgCCGTGATGCCGGCGCCCTtggtgccgtggtggtggtgttcttGTTGTTTGGTGTTGTTCGGGAGGGAGAGGTGTGGGGATCACGTCCTCTAAAGATCTCCCAGTATCAGGCTGATTCACTCACGATGTGGTCGACGGACAGGTTGGGTTATGAGAGGGGCGGTGCTCTTCGATGCAGCGTCGTATGTTGCAGCGTGCaggtTCCCATCCAATACGTCTACGTCCGCCGTAGCAGCAAGATGTCACTAAGATGTGATGTTTGCGGGAAGAGTTGTCCATCCTCAAGCAAACTCACCGTCCACATGCGGGTGCACACCGAGGAAAAGCcgttcgagtgcaccgtgtgccaaaAGAAGTTTCAACAATCTGGAGATCTGAAAaaacatcttcgaacccacacaggcgagaaacctttcgagtgcaccgtgtgccaaaAGAAGTTTGATCGACCTAACGGTTTAAAGGTACACCTTcgcacccacacaggcgagaggccgtttgagtgcaccgtATGCCAAAAGAAGTTTCAACAATCTGGAGATCTGAGAaaacatcttcgaacccacacaggcgagaaacctttcgagtgcaccgtgtgccaaaAGAAGTTTGATCGACCTGACAGTGTAAAGGCGCACCTTCGCATCCACACAGGCGAGAGgccgtttgagtgcaccgtATGCCAAAAGAAGTTTCAACAATCTGGAGATCTGAAAaaacatcttcga
Protein Sequence: MKRWCGGGGCRDAGALGAVVVVFLLFGVVREGEVWGSRPLKISQYQADSLTMWSTDRLGYERGGALRCSVVCCSVQVPIQYVYVRRSSKMSLRCDVCGKSCPSSSKLTVHMRVHTEEKPFECTVCQKKFQQSGDLKKHLRTHTGEKPFECTVCQKKFDRPNGLKVHLRTHTGERPFECTVCQKKFQQSGDLRKHLRTHTGEKPFECTVCQKKFDRPDSVKAHLRIHTGERPFECTVCQKKFQQSGDLKKHLR

Sequence clustering based on sequence similarity using MMseqs2