Focc006596.1
Basic Information
- Insect
- Frankliniella occidentalis
- Gene Symbol
- -
- Assembly
- None
- Location
- ML763035.1:409794-412144[-]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 7 0.78 6.4e+02 0.5 0.2 26 48 56 78 51 83 0.79 2 7 6 4.9e+03 -2.4 0.1 23 31 91 99 86 115 0.70 3 7 1.5e-07 0.00013 21.9 0.3 18 50 112 144 106 148 0.87 4 7 0.0016 1.3 9.1 0.5 19 37 152 170 143 173 0.84 5 7 0.009 7.4 6.7 0.5 25 49 212 236 174 240 0.88 6 7 0.8 6.6e+02 0.4 0.1 27 46 272 291 262 296 0.85 7 7 5.3e-05 0.044 13.8 1.8 25 48 296 319 288 323 0.85
Sequence Information
- Coding Sequence
- atGTCggggtcgtcctcgtcgtcgccgtcctcctcgctcCTCCGGGACGTGgccgtcgccggcggcgggccgggcaccgggcccttccgctgcggcacctgcgggaGGACCTTCAGCCGCAACGACTCGCTGGCGCACCACAAGACCATCCACACGGGGCAGACCCGGTGCCCGGTCTGCGGCGTGCTCTTCACCAGGAAGTACACCATGAAGTGCCACCTGTTCACCGCCCACGGCATCAAACGTAACGAAAACAATAAACGGAAGGTCCATCCAGTTTACTGCGACATCTGCGGCAAGGGCTTCCAGATCCGCGACTCGCTGTACAAGCACCGCAGcgtgcaccgcggcgccacGACCTGTCCCATCTGCCAGGCCGTGCTGAACCGCAAGGGCTACCTGCGGCGCCACCTGGCCACGGTGCACGGCGCCGACTCCgtcgccagcgccaccagcgccgccagcgcgcccaccacctgTCCCATCTGCAGAGTAGGGCTGAGAGCGAgcgccgccggccccgcgcgcaagccctcgcggcccccgcccggccaccacgtGTGTCGCACCTGCGGCAAGCGCTTCCGCCACCGCAGCTCGCTGAGCAAGCACCAGCACGTGCACCGGGGCACGACCgtgtgcgcgctgtgcggcgccgtCCTGAGCTCCATCGACTACCTCAAGCGGCACGTGGACGCCGTGcactACTTTCTGACGGCGGGCTCGTCCTTTGGCTCGGCCTTCGGGTCGCCGCCGACTCTGCATGaggccccctcggcggcggcggcggcgaacgcgTCCGGGCGGTACGAGTGCGCGCTCTGCGGCAAGACGTTCtacgcgcgccgctcgctgcggcAGCACGTCAGCGTGCACAAGGGCGCCACCCGCTGCCCCATCTGCTACACGGTGCTGAGCCGGCGCGCGCACCTGTTCCGGCACCTGGCCGCGGTGCACAACGTGCAGGCCGACCAGGCGGCCGCGCAGTGA
- Protein Sequence
- MSGSSSSSPSSSLLRDVAVAGGGPGTGPFRCGTCGRTFSRNDSLAHHKTIHTGQTRCPVCGVLFTRKYTMKCHLFTAHGIKRNENNKRKVHPVYCDICGKGFQIRDSLYKHRSVHRGATTCPICQAVLNRKGYLRRHLATVHGADSVASATSAASAPTTCPICRVGLRASAAGPARKPSRPPPGHHVCRTCGKRFRHRSSLSKHQHVHRGTTVCALCGAVLSSIDYLKRHVDAVHYFLTAGSSFGSAFGSPPTLHEAPSAAAAANASGRYECALCGKTFYARRSLRQHVSVHKGATRCPICYTVLSRRAHLFRHLAAVHNVQADQAAAQ
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00733441;
- 90% Identity
- iTF_00733441;
- 80% Identity
- iTF_00733441;