Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.00048 0.4 10.7 0.1 26 46 33 53 14 59 0.82

2 5 0.00023 0.19 11.7 0.1 21 45 56 80 52 83 0.91

3 5 0.0012 0.96 9.5 0.1 21 48 84 111 80 115 0.86

4 5 0.0052 4.3 7.4 0.1 21 47 112 138 110 144 0.86

5 5 4.7 3.9e+03 -2.0 0.2 18 37 232 249 221 253 0.63

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.00048	0.4	10.7	0.1	26	46	33	53	14	59	0.82
2	5	0.00023	0.19	11.7	0.1	21	45	56	80	52	83	0.91
3	5	0.0012	0.96	9.5	0.1	21	48	84	111	80	115	0.86
4	5	0.0052	4.3	7.4	0.1	21	47	112	138	110	144	0.86
5	5	4.7	3.9e+03	-2.0	0.2	18	37	232	249	221	253	0.63

Coding Sequence: ATGAACGGACAGACACCTCCACACCAGCGCTCCGTGAGCAACAAAATAGTCCCCGGTGCAGATAACCTTGAGCAACATCACCGTCCTCACCAatttgagtgcaccgtgtgctaTAAATTATTTTCTCGGTCTGACAATCTGCAGAAACATCTGCGGgcccacacaggggagaagccgtttgagtgcactGTATGTCACAAAACGTTTACTCAAGCTAGCAATCTTCGGGTACACCTGCGcacccacacaggggagaagccgtttgagtgcaccgtgtgccacaaaaagGTTGCAACAAGTTCCGAACTCCGCAGCCATCTGCGtttccacacaggagagaagccatttgagtgcactgtgtgccacaaaaAGTTTGCAAGAAGTTCCGATCTCCGGGTGCATCTGCGtacccacacaggggagaagccaTTGTGTGCCACAAAACCTTTACTCAAGCAAGCAGTCGTCGGGTACACCTGCGCACCCACACAGaggagaagccttttgagtgcactgtgtgccacaaaaAGGTTGCAACAAGTTACTATCTCCGGGTACATCTGCGtacccacacaggggagaagccatttgagtgcactgtgtgccacaaaaAGTTTGCAAGAAGTTCCGATCTCCGGGTGCATCTGCGtacccacacaggggagaagccattcgagtgcaccgtgtgccacaaaaagTTTGCAGGAAGTTCCGAACTCCACATGCATCTGCGttctcacacaggagagaagccatttgagtgcactgtgtgccacaaaaAGTTTGCTCACATTGGCAATCTGCAGGTACACCTGCGcacccacacaggggagaagccgtttgcgtgcactgtgtgccacaaaaTGTTTTCAACAAGTTACGAACTCCGGCTGCATCTCcgtacccacacaggagagaagccctttaagtgcactgtgtgccacaaaaCGTTTTCTCAGTCTTGCAATCAAAGGAGACATCTGCGCACCCACACAGTCGATAGATTGGTGCAGAGAACCACGTGCTGAAATCATCTTTAAGGAGCAATCGGCGGCGTCGTATTGTTTCCTGAACAGAAGGTGA
Protein Sequence: MNGQTPPHQRSVSNKIVPGADNLEQHHRPHQFECTVCYKLFSRSDNLQKHLRAHTGEKPFECTVCHKTFTQASNLRVHLRTHTGEKPFECTVCHKKVATSSELRSHLRFHTGEKPFECTVCHKKFARSSDLRVHLRTHTGEKPLCATKPLLKQAVVGYTCAPTQRRSLLSALCATKRLQQVTISGYICVPTQGRSHLSALCATKSLQEVPISGCICVPTQGRSHSSAPCATKSLQEVPNSTCICVLTQERSHLSALCATKSLLTLAICRYTCAPTQGRSRLRALCATKCFQQVTNSGCISVPTQERSPLSALCATKRFLSLAIKGDICAPTQSIDWCREPRAEIIFKEQSAASYCFLNRR

Sequence clustering based on sequence similarity using MMseqs2