Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.001 0.83 9.7 0.1 22 45 17 40 8 43 0.89

2 5 0.003 2.5 8.2 0.1 21 46 44 69 40 75 0.86

3 5 0.00084 0.69 10.0 0.2 21 45 72 96 68 99 0.91

4 5 0.0045 3.7 7.6 0.1 21 46 100 125 96 131 0.86

5 5 0.045 37 4.4 0.1 21 47 128 154 124 160 0.84

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.001	0.83	9.7	0.1	22	45	17	40	8	43	0.89
2	5	0.003	2.5	8.2	0.1	21	46	44	69	40	75	0.86
3	5	0.00084	0.69	10.0	0.2	21	45	72	96	68	99	0.91
4	5	0.0045	3.7	7.6	0.1	21	46	100	125	96	131	0.86
5	5	0.045	37	4.4	0.1	21	47	128	154	124	160	0.84

Coding Sequence: ATGCCTGCACCTCATTGCGCAAGCGGGGCCCAGACTTCGCACACAATAGATaagccattcgagtgctccGTATGCACCAAGACTTTTGCTAGTTCTAGACACCTGCGTACTCATctgcgaacgcacacaggagagaagccgttcgagtgctccgtgtgcaacaagacttTTGCACGTTCTAGTCACCTGCGTATTCATCTGCgtacgcacacaggagagaagccgttcgagtgttcCGTATGCAACAAGACTTTTGCTTTATCTTGCAACCTGCGTACTCATCTgcgaacacacacaggagagaagccgttcgagtgctccgtgtgcaacaagacttTTGCAAGTTCTAGTCACCTGCGTATTCATCTGCgtacgcacacaggagagaagccgttcgagtgtttTGTATGCAACAAAACTTTTGCAAGTTCTACTCACCTGCATACTCATCTGCGAACACACACAGaagagaagccgttcgagtgctcCCTGCGCGTGGTATGA
Protein Sequence: MPAPHCASGAQTSHTIDKPFECSVCTKTFASSRHLRTHLRTHTGEKPFECSVCNKTFARSSHLRIHLRTHTGEKPFECSVCNKTFALSCNLRTHLRTHTGEKPFECSVCNKTFASSSHLRIHLRTHTGEKPFECFVCNKTFASSTHLHTHLRTHTEEKPFECSLRVV

Sequence clustering based on sequence similarity using MMseqs2