Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 4.1 3.4e+03 -1.9 0.0 28 47 118 139 116 144 0.64

2 6 0.0074 6.1 6.9 0.0 21 46 156 181 152 187 0.86

3 6 0.025 20 5.3 0.0 21 47 184 210 180 216 0.83

4 6 0.012 9.9 6.3 0.0 21 46 212 237 208 243 0.86

5 6 8e-05 0.066 13.2 0.0 21 46 240 265 236 271 0.86

6 6 0.008 6.6 6.8 0.0 21 47 268 294 264 301 0.86

#	of	c-Evalue	i-Evalue	score	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	4.1	3.4e+03	-1.9	28	47	118	139	116	144	0.64
2	6	0.0074	6.1	6.9	21	46	156	181	152	187	0.86
3	6	0.025	20	5.3	21	47	184	210	180	216	0.83
4	6	0.012	9.9	6.3	21	46	212	237	208	243	0.86
5	6	8e-05	0.066	13.2	21	46	240	265	236	271	0.86
6	6	0.008	6.6	6.8	21	47	268	294	264	301	0.86

Coding Sequence: CTGTCGCTGACGCTGGTGAACAGACAGAGCTTCTGTGGAGGCGAACCGGGACAAACTGCGTTCCTTCTTCAGGTACATCAAACTCATTCTGAATTCTCACCATGTTGGCGGAGTGCGACCCAAGTTCGGACGAGAAAGAGCATTTCTTTGGCCTTACTACCCGTGAACCGACATTTTCGAAAAAACATTTTATATTACGTCTCCGCACACACAGAGAAGAAAAATCTTTTAAATGTGATTTCTGTAAAAAGACATTTTCACGTAACTACACTCTGCGTGAACATCTCCGcgcccacacaggagagaaacctttcgaaTGTGATGtttgtaacaagaaattttcacatGACTCCACTCTGCGTACACATCTCcgtacccacacaggagagaaacctttcgagtgtaATGTTTGTAAGAGGACATTTTCAGCGGGTTACACTCTGCGTGATCATCTCCgtacacacaggagagaaacctttcgaaTGTGCTTTGTGTAACAAGACATTTTCAGCGGGTTCCAATCTGCGTGCTCATCTacgcacccacacaggagagaaaccttttgagtgtgatgtgtgtaagaAGAGTTTTGCTCGGAATTCCACTCTGCGGCAACATCTCcgtacccacacaggagaaaaaccttttgagtgtgatgtgtgtaagaAGACATTTCCAGCGGGGACCAATCTGCGTGAtcatctccgcacccacacaggagagaaacctttcgagtgtaATGTTTGttacaagaaattttcacagGACTCCAGTCTGCGTAAACATCTCcgtacccacacaggagagaaaccttttgagtgtgatgtgtgtaagaAGACTTTTGCCCAGGATTCCACTCTGCGTGTTCATCTCcgtacccacacaggagagaaacctttcgagtgtaATGTTTGTAAGAGGACATTTTCA
Protein Sequence: LSLTLVNRQSFCGGEPGQTAFLLQVHQTHSEFSPCWRSATQVRTRKSISLALLPVNRHFRKNILYYVSAHTEKKNLLNVISVKRHFHVTTLCVNISAPTQERNLSNVMFVTRNFHMTPLCVHISVPTQERNLSSVMFVRGHFQRVTLCVIISVHTGEKPFECALCNKTFSAGSNLRAHLRTHTGEKPFECDVCKKSFARNSTLRQHLRTHTGEKPFECDVCKKTFPAGTNLRDHLRTHTGEKPFECNVCYKKFSQDSSLRKHLRTHTGEKPFECDVCKKTFAQDSTLRVHLRTHTGEKPFECNVCKRTFS

Sequence clustering based on sequence similarity using MMseqs2