Focc014074.1
Basic Information
- Insect
- Frankliniella occidentalis
- Gene Symbol
- -
- Assembly
- None
- Location
- ML763329.1:2529-32523[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 6 0.13 1.1e+02 2.9 0.0 22 46 51 75 27 81 0.87 2 6 7.3e-05 0.06 13.4 0.1 21 44 78 101 74 105 0.91 3 6 0.00034 0.28 11.2 0.0 21 46 106 131 101 137 0.84 4 6 0.033 27 4.8 0.0 21 43 134 156 130 161 0.89 5 6 8.7e-05 0.072 13.1 0.0 18 45 159 186 154 189 0.88 6 6 0.0064 5.3 7.1 0.0 21 44 190 213 186 214 0.91
Sequence Information
- Coding Sequence
- ATGCAACAAGAAACTCTCGAAGTTGGAACCTCCGTGTTCATTtccgaacccacactgGTCAGCCTAAATGTGCATCAGCATCGCCCTAAGACCTATCAACATCAACTAGAAAGGGCACAATCGAAGGACATCAACATGGTGAACGCACGGAAAAAGCCTCTTCAGTGCATCGTATGCCTCAAGACTTTTGCTCAGTTTGGTAAGCTGAAGACTCATCTAcgaacccacactggggaaaagccatttgagtgcaccgtgtgccacaaatCCTTTTCTCAGTCTGGCAATCTAAAGAGACATCATCGTACCCActctggagaaaagccatttgattGCAGCTTGTGCTACAAATCGTTTGCTGCAAGTGGTGACTTGAAGAAACATTTAcgaacccacactggggaaaagccaTTTAAGTGCGCCGTGTGCCTTGAATCCTTTTCTCAGTCTGGCAGTCTAAAGATACATCAAAGTacccacactggggaaaagccatttgagtgcaccgtgtgccacgaATCCTTTTCTCAGTCTGGCAATCTAAAGACACATCTacgcacccacactggagaaaagccatttgattGCAGTTTGTGCTACAAATCGTTTGCTATAAGTGGTGATTTGAAGACTCATCTACGAAC
- Protein Sequence
- MQQETLEVGTSVFISEPTLVSLNVHQHRPKTYQHQLERAQSKDINMVNARKKPLQCIVCLKTFAQFGKLKTHLRTHTGEKPFECTVCHKSFSQSGNLKRHHRTHSGEKPFDCSLCYKSFAASGDLKKHLRTHTGEKPFKCAVCLESFSQSGSLKIHQSTHTGEKPFECTVCHESFSQSGNLKTHLRTHTGEKPFDCSLCYKSFAISGDLKTHLR
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00733434;
- 90% Identity
- iTF_00733434;
- 80% Identity
- iTF_00733434;