Fcup000121.1
Basic Information
- Insect
- Ferdinandea cuprea
- Gene Symbol
- slp1_1
- Assembly
- GCA_963576555.1
- Location
- OY754958.1:2084767-2085657[+]
Transcription Factor Domain
- TF Family
- Fork_head
- Domain
- Fork_head domain
- PFAM
- PF00250
- TF Group
- Helix-turn-helix
- Description
- The fork head domain is a conserved DNA-binding domain (also known as a winged helix) of about 100 amino-acid residues. Drosophila melanogaster fork head protein is a transcription factor that promotes terminal rather than segmental development, contains neither homeodomains nor zinc-fingers characteristic of other transcription factors [1]. Instead, it contains a distinct type of DNA-binding region, containing around 100 amino acids, which has since been identified in a number of transcription factors (including D. melanogaster FD1-5, mammalian HNF-3, human HTLF, Saccharomyces cerevisiae HCM1, etc.). This is referred to as the fork head domain but is also known as a 'winged helix' [1, 2, 3]. The fork head domain binds B-DNA as a monomer [2], but shows no similarity to previously identified DNA-binding motifs. Although the domain is found in several different transcription factors, a common function is their involvement in early developmental decisions of cell fates during embryogenesis [3].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 3.6e-41 5.2e-38 129.9 0.2 1 87 102 187 102 188 0.97
Sequence Information
- Coding Sequence
- atggtGCAAAACATGTCTGGATtagaattcaaaacaaatttctcaATTGATGCCATCCTTTCAAACAATATCAAGAAGGAATGCCAGGAAGTGATTTCCAAAAAGCCAAATGTGTTGACGGAAAACTATTGCGACGGTGATTTGACTTCATCGTCGGAGGACTTTGAGCATCCATCAAGAACCAGTACTCCCATGAGTAGTGTAGCTGAATCACTGTCATCAGGAGAGGATAAGATCGATGGGGAGAGTTGCGATGGCGATGCAGATGCCGATAGTGGTGATGATAAAAAAGATGGGGATGAGAAGAAACCCCCATATAGCTACAACGCGCTGATCATGATGGCTATTCAGGACAGTCCCGAACAGCGATTGACTTTGAACGGTATCTACCAGTATCTTATGAATAGATTTCCATACTTCAAAATGAACAAACGCGGATGGCAAAATTCTATTCGCCACAATCTGAGTTTAAACAAGTGCTTCACGAAAATTCCACGCAGCTACGATGATCCCGGCAAGGGCAACTACTGGATCTTGGACCCCAGCGCTGAGGAAGTATTCATCGGTGAGACAACCGGCAAATTGCGCAGAAAGAACCCAGGAGCAAACAGATCAAGATTAGCGGCCTACCGCCAAGCAGTATTCTCACCAATCCTCGGAAGTTATGGCGCCGCTCCACAATTCAACCCATCGCCATACAGCAACTACGtgggagcagcagcagcagccgccCTATACCAACGATTGGCTCCTCCATCTTACCACGCTGGATACCCAGGACAGGGTGCATACCCTTCCAATCCGTACGCGATGTCAATGCAACAAGCAGCCATTAACCCCGCAGAAATGCTTCAGCGAATGCAGTTCTTCAACAAATATGGAACCAGTTAA
- Protein Sequence
- MVQNMSGLEFKTNFSIDAILSNNIKKECQEVISKKPNVLTENYCDGDLTSSSEDFEHPSRTSTPMSSVAESLSSGEDKIDGESCDGDADADSGDDKKDGDEKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLMNRFPYFKMNKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRRKNPGANRSRLAAYRQAVFSPILGSYGAAPQFNPSPYSNYVGAAAAAALYQRLAPPSYHAGYPGQGAYPSNPYAMSMQQAAINPAEMLQRMQFFNKYGTS
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00240467; iTF_00688407; iTF_00991563; iTF_01253345; iTF_01521682; iTF_00976259; iTF_01396291; iTF_01520772; iTF_01522369; iTF_00310022; iTF_00313250; iTF_00314950; iTF_01541962; iTF_01299819; iTF_00389421; iTF_01541232; iTF_01223190; iTF_01116251; iTF_00315742; iTF_00426921; iTF_00426153; iTF_00974443; iTF_01318030; iTF_00187854; iTF_00241296; iTF_00663858; iTF_00693586; iTF_00664659; iTF_00334772; iTF_00694397; iTF_00984031; iTF_00893664; iTF_01211704; iTF_01356665; iTF_01044539; iTF_01395635; iTF_00311606; iTF_00312391; iTF_01300631; iTF_00314070; iTF_00310814;
- 90% Identity
- iTF_00313250;
- 80% Identity
- -