Eaur012059.1
Basic Information
- Insect
- Euspilapteryx auroguttella
- Gene Symbol
- Ssb-c31a
- Assembly
- GCA_951802225.1
- Location
- OX637652.1:3736083-3736508[+]
Transcription Factor Domain
- TF Family
- PC4
- Domain
- PC4 domain
- PFAM
- PF02229
- TF Group
- Unclassified Structure
- Description
- This domain is found at the C-terminal end of Activated RNA polymerase II transcriptional coactivator p15 from humans, YdbC from Lactococcus lactis, and other PC4 family members. p15 has a bipartite structure composed of an N-terminal regulatory domain and a carboxy-terminal cryptic DNA-binding domain [1-4]. Activity is controlled by protein kinases that target the regulatory domain.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 5.7e-29 1.4e-24 85.8 0.6 1 51 44 94 44 95 0.96
Sequence Information
- Coding Sequence
- ATGCCGAAAAATAAGAAGAAAGCGGAGTCTTCTTCAAGCGACAGTGATGAGGGCCCAATCGATCGCCAACCCCCTGAAAAGAAAGCAAAAGGCTCAAGCTCATTCCGTACAGATGCAAAAGAGCCAACATGGGTACTGCAAGGAACAAAAATGGTGAAAGTGCGAGAGTTTAAAGGAAAGGTCTATGTTGATATTCGCGAGTATTATGAAAAGAATGGTGAAATGTTGCCTGGGAAGAAAGGCATTAGTTTGACACCAGACTTATGGCGTAAGCTGATTGATTTAGGAGAGGAGATCACAGCTGAAATAAGCTCTAAATGttaa
- Protein Sequence
- MPKNKKKAESSSSDSDEGPIDRQPPEKKAKGSSSFRTDAKEPTWVLQGTKMVKVREFKGKVYVDIREYYEKNGEMLPGKKGISLTPDLWRKLIDLGEEITAEISSKC
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -