Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.00034 15 8.6 0.2 20 49 14 43 8 47 0.89

2 6 0.025 1.1e+03 2.6 0.5 21 48 44 71 41 76 0.72

3 6 0.0072 3e+02 4.3 0.5 20 48 72 100 64 100 0.84

4 6 1.1e-06 0.045 16.6 0.1 15 49 96 130 85 134 0.89

5 6 2.5e-05 1.1 12.2 0.1 20 49 130 159 126 164 0.88

6 6 0.043 1.8e+03 1.9 0.1 22 49 161 193 159 198 0.60

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.00034	15	8.6	0.2	20	49	14	43	8	47	0.89
2	6	0.025	1.1e+03	2.6	0.5	21	48	44	71	41	76	0.72
3	6	0.0072	3e+02	4.3	0.5	20	48	72	100	64	100	0.84
4	6	1.1e-06	0.045	16.6	0.1	15	49	96	130	85	134	0.89
5	6	2.5e-05	1.1	12.2	0.1	20	49	130	159	126	164	0.88
6	6	0.043	1.8e+03	1.9	0.1	22	49	161	193	159	198	0.60

Coding Sequence: ATGGGAGGCCAGCTTAAATCACATATTATGGCCAAGCATACAAATGAAAAACCACATCACTGCAAATTATGTGATTACAGGGCCACGCAATCTAGTCAACTTAAGTCTCATATGATGTTTAAACACACAAACGAGAAACCGAAACAATGCCCTCATTGCGAATATAGAACGGTGATGACGGGTCAACTTAAGGCACATATAATGGCCAAACATACAAATGAAAAACCTCAcaagtgtcctcattgtgaataTAGAGCGACCCAAGGTGGTGATATCAACAAACATATAAGGTCGAAGCATAGTTCTGAAAAACCATTCCAGTGCCCATTCTGTGACCATAAAGCATCACTTTCAGGCTCTCTACGCAAACACATAATGGCCAAGCATACTAATGAAAAACCTTATCAGTGCCCTTATTGTGATTATCGAGCTACTCAATCCGGGCAGCTGAGAGGCCATGTCATGTTCAAGCATACCAACGAGAAGCCTCACAAGTGCTCTCACTGTGGCTACAAAGCGACCCGTGCTGACAGCCTCAAGAGTCACCTAGTGAGGAAGCATCCAGAACTGAACACTTTTGATGAATCTGAAGTTATTTGTGATGCATAA
Protein Sequence: MGGQLKSHIMAKHTNEKPHHCKLCDYRATQSSQLKSHMMFKHTNEKPKQCPHCEYRTVMTGQLKAHIMAKHTNEKPHKCPHCEYRATQGGDINKHIRSKHSSEKPFQCPFCDHKASLSGSLRKHIMAKHTNEKPYQCPYCDYRATQSGQLRGHVMFKHTNEKPHKCSHCGYKATRADSLKSHLVRKHPELNTFDESEVICDA*

Sequence clustering based on sequence similarity using MMseqs2