Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.0029 1.2e+02 5.6 0.0 21 48 6 33 2 38 0.86

2 7 0.0018 76 6.3 0.6 21 49 35 63 31 68 0.81

3 7 0.00023 9.7 9.1 0.1 18 49 61 92 59 96 0.89

4 7 0.0018 76 6.3 0.0 18 48 90 120 89 122 0.89

5 7 0.00047 20 8.1 0.9 21 48 122 149 118 151 0.80

6 7 3.1e-05 1.3 11.9 0.2 18 50 148 180 146 184 0.88

7 7 0.024 1e+03 2.7 0.2 26 48 188 210 185 213 0.90

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.0029	1.2e+02	5.6	0.0	21	48	6	33	2	38	0.86
2	7	0.0018	76	6.3	0.6	21	49	35	63	31	68	0.81
3	7	0.00023	9.7	9.1	0.1	18	49	61	92	59	96	0.89
4	7	0.0018	76	6.3	0.0	18	48	90	120	89	122	0.89
5	7	0.00047	20	8.1	0.9	21	48	122	149	118	151	0.80
6	7	3.1e-05	1.3	11.9	0.2	18	50	148	180	146	184	0.88
7	7	0.024	1e+03	2.7	0.2	26	48	188	210	185	213	0.90

Coding Sequence: atggCACATCACACGGGTGAGAAGCCTtataaatgtcctcattgtgactttAAATCTGTAGACTCTGGCggtttaaaaagacatataatggcatatcatacaggtgagaagccttataaatgtcctcattgtgactataattCAATAGagagatatttattaaaaagacatataatggcccgccatacaggtgagaagccgtATAAATGTCTTCATTGTGACTTTAAAGCATCATTATCTGGtaatttaaaaagacatataatggctcgtcatacaggtgagaagccttataAATGTGACCATTGTGATTTCAAATCAGCTCAATCTGGAggtttaaaaagacatataatggCACATCATACGGgtgagaagccttatacatgtcctcattgtgactataattCAGTAGagagatatttattaaaaagacatataatggcccgtcatactggtgagaagccttatAAATGCCCTCACTGTGAATATAAAGCAGTACAAAATggcacattaaaaaaacatttaatggcccgtcatacagATGGCCCGCCATACAAGTGCCATAAATGTCCTCACTGTGAATTTAAAGTAGTGCAACATGGCACATTAACAAAACAtgtaatggcccgtcatacaggtgtAATGTCCTAA
Protein Sequence: MAHHTGEKPYKCPHCDFKSVDSGGLKRHIMAYHTGEKPYKCPHCDYNSIERYLLKRHIMARHTGEKPYKCLHCDFKASLSGNLKRHIMARHTGEKPYKCDHCDFKSAQSGGLKRHIMAHHTGEKPYTCPHCDYNSVERYLLKRHIMARHTGEKPYKCPHCEYKAVQNGTLKKHLMARHTDGPPYKCHKCPHCEFKVVQHGTLTKHVMARHTGVMS*

Sequence clustering based on sequence similarity using MMseqs2