Basic Information

Transcription Factor Domain

TF Family: BTB
Domain: zf-C2H2|ZBTB
PFAM: PF00651
TF Group: Zinc-Coordinating Group
Description: The BTB (for BR-C, ttk and bab) [6] or POZ (for Pox virus and Zinc finger) [1] domain is present near the N-terminus of a fraction of zinc finger (Pfam:PF00096) proteins and in proteins that contain the Pfam:PF01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation [1]. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule [2]. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT [5, 3, 4]. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 9.7 7.2e+03 -1.0 0.1 72 108 66 101 62 124 0.73

2 3 5.4e-27 4e-24 86.7 0.3 2 109 154 259 153 260 0.93

3 3 4.5 3.3e+03 0.1 0.0 79 108 261 290 258 291 0.82

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	9.7	7.2e+03	-1.0	0.1	72	108	66	101	62	124	0.73
2	3	5.4e-27	4e-24	86.7	0.3	2	109	154	259	153	260	0.93
3	3	4.5	3.3e+03	0.1	0.0	79	108	261	290	258	291	0.82

Coding Sequence: ATGAGCTGCCCAGATATAAAAGAATTACAATTTTCAGTTCAAAAGTTAAACATTGATTTTTATCGAGCAACCTTATCATGGAATATCAACCCTTTTTCTTATAATATTGACTATGAAACTGTAGCGATTTGTAAAGTTGAATCCAACTCGTATAAATATAGTTTCAAACTACAAAGAGATAATATAACGAAAATCTATAATCTGCACATTGAATTGATGTCAAGTCTGCAGAATATTAGTAATTGCGCAACAATTTATAGTATTTATAACGATAGTGATAAAATTCATCATGGTATGATCACAAATCTCATGCTTTCGATTCCTAAAAAATTATCACTCAATAATTTTACAAAACATAAATGTAGTTCAAAATTAGTAGTAATTTGCAAACTTAAACTCTATACAAAAGCGAGCAATGAAAAGATTTCCCAAGATCTTGAAAAAATGTCCAAAGACTTTGAAAACTTACTTGTGAGTGAGCGGCTCAGTGATTGTGTTTTAAAATCAAAGGAAGCCCAGTTTAAGGTGCACAAGGCTGTTTTATCAGCTCGTAGTTCCGTGTTCGCTGCCATGTTTAAATACGGCACAAAGGAATGCCACGAAGGAATCATCAATATTGAAGATATCGATGCCGACGTCCTCCGATCGATGATCGATTATATCTACAAGGGTAAAGTGAAGGATATTGATACCAAAGGACATGATCTCTTCAATGTTGCTGAAAAATACGGCTTGGATGAACTCAGGACAATGTGTGAGGAAGTAGTATGTAAGAATCTTACAATAAAAAATGTTATCGATAATCTGTTAATGGCTGATGTGTATAATAATGAAAACATTAAAAAAGCCTCCTTTATATTTATAAAGAATAATTTCAATTCTGTACTATTAAGATTTGTATACAAACAACTTCAAACCTCTTATCCGCACTTACTCCAGGGGTTAATGGACACACTAGTACACCATAAAGATTTTTAA
Protein Sequence: MSCPDIKELQFSVQKLNIDFYRATLSWNINPFSYNIDYETVAICKVESNSYKYSFKLQRDNITKIYNLHIELMSSLQNISNCATIYSIYNDSDKIHHGMITNLMLSIPKKLSLNNFTKHKCSSKLVVICKLKLYTKASNEKISQDLEKMSKDFENLLVSERLSDCVLKSKEAQFKVHKAVLSARSSVFAAMFKYGTKECHEGIINIEDIDADVLRSMIDYIYKGKVKDIDTKGHDLFNVAEKYGLDELRTMCEEVVCKNLTIKNVIDNLLMADVYNNENIKKASFIFIKNNFNSVLLRFVYKQLQTSYPHLLQGLMDTLVHHKDF

Sequence clustering based on sequence similarity using MMseqs2