Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.039 6.4e+02 1.4 0.1 21 43 6 28 4 34 0.80

2 6 3.4e-05 0.54 11.2 0.1 21 43 34 56 29 61 0.81

3 6 0.011 1.9e+02 3.1 0.2 26 46 67 87 59 97 0.85

4 6 0.02 3.3e+02 2.3 0.1 21 31 118 128 114 144 0.79

5 6 0.0049 79 4.3 0.0 21 48 146 173 137 177 0.84

6 6 5.4e-05 0.88 10.6 0.0 21 51 174 204 172 205 0.87

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.039	6.4e+02	1.4	0.1	21	43	6	28	4	34	0.80
2	6	3.4e-05	0.54	11.2	0.1	21	43	34	56	29	61	0.81
3	6	0.011	1.9e+02	3.1	0.2	26	46	67	87	59	97	0.85
4	6	0.02	3.3e+02	2.3	0.1	21	31	118	128	114	144	0.79
5	6	0.0049	79	4.3	0.0	21	48	146	173	137	177	0.84
6	6	5.4e-05	0.88	10.6	0.0	21	51	174	204	172	205	0.87

Coding Sequence: ATGCATCTTCACACTGGAGAAAAGCCTTATAATTGCAAAGTTTGCAACAAGTCATTCCGGCACCGGACCACGCTGGCTCTACACTCTGTGCTCCATGCCGGCGAGAAGCCTTACACATGTCCTATATGTAAGAGTGTCTTCGATCTTAAGCCTCTTCTACACAAACATATAGCGACCCACACTGACAACTCCTcatatgtgtgcaaaatttgcAGCAAAGTATTTGTTCATAGTGTTCTTTTGAAGCAACATGTGAAAATTCACATGGATACAAGACGTTTTACTTGCGACATGTGTGGCAGATCATTCTATAAAAACTCAGCTTTATTAAATCACATGACAACACACACTGGAGAAAAGCCATTTACATGTGATGTATGTGAGAAGTCTTTTCCTCATAAGAAAACTTTAGTGGCTCACAGAAGGATACACACAGGTGAGAAACCATACTCATGTGATGTTTGCAATAAGAAGTTTACTTTCAACCATGGCCTGAACAGACATTTTAAAATACACACTGGAGAAAAACCATTTAGCTGCAGCATCTGTAACATGTCATTTATTGGAGGTGATAAATTGAGAAGACATTTGAAAGTGCATAGTAAAGAGAAACCTTAG
Protein Sequence: MHLHTGEKPYNCKVCNKSFRHRTTLALHSVLHAGEKPYTCPICKSVFDLKPLLHKHIATHTDNSSYVCKICSKVFVHSVLLKQHVKIHMDTRRFTCDMCGRSFYKNSALLNHMTTHTGEKPFTCDVCEKSFPHKKTLVAHRRIHTGEKPYSCDVCNKKFTFNHGLNRHFKIHTGEKPFSCSICNMSFIGGDKLRRHLKVHSKEKP

Sequence clustering based on sequence similarity using MMseqs2