Basic Information

Transcription Factor Domain

TF Family: zf-LITAF-like
Domain: zf-LITAF-like domain
PFAM: PF10601
TF Group: Zinc-Coordinating Group
Description: Members of this family display a conserved zinc ribbon structure [3] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS)[2]. The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 6.1e-08 0.0003 22.4 7.1 2 45 55 99 54 113 0.77

2 3 8.7e-05 0.43 12.3 1.6 2 23 144 165 143 169 0.88

3 3 0.00012 0.59 11.9 0.6 56 69 171 184 168 185 0.90

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	6.1e-08	0.0003	22.4	7.1	2	45	55	99	54	113	0.77
2	3	8.7e-05	0.43	12.3	1.6	2	23	144	165	143	169	0.88
3	3	0.00012	0.59	11.9	0.6	56	69	171	184	168	185	0.90

Coding Sequence: ATGAGTCAACCATCAGCTGAAAACGCCGCTGCCGCTACCGCCACCACCGGAGGCGGTGCCGAAACTCACAATCAAACATCTGAAGATAAACAAATCGAaaatcaaaagatatttgataatTTTGCAACACCGTTAGTTGGACAATTTCTTAACCTACCCAAAGAGCCGGTGGAAGTAACTTGTCCGGCATGTCACATCCGCGCTCCGTCCGAAGTCATTCGAGACCTTAAATGGTATACCAGTACCGTGAATGGAATCTATTCATTTCTCTTTATattgtgttgctgctgtttttgtCGAAGTTTTTCACATCCATCTTCAACCAAAACCCTAAACATGTCTGAAGTTCAAACAACTTTGATTCAGGATGATCCTGCCCCAATGAAATTGATCGTTGCTCCAAAAGTATTCTATTTTGCAGTCGGTCCAAATTCCCATGAGGTCACTTGTCCATTTTGTAAGATCCAAGCCAAGACCACCGTCAAGAGGAAATACCTTAAATGCTATCGTCAGCATTATTGTTCCAGTTGTGGCGAATATTTGGGAACTTTTCGAAGACCGCAACTTtag
Protein Sequence: MSQPSAENAAAATATTGGGAETHNQTSEDKQIENQKIFDNFATPLVGQFLNLPKEPVEVTCPACHIRAPSEVIRDLKWYTSTVNGIYSFLFILCCCCFCRSFSHPSSTKTLNMSEVQTTLIQDDPAPMKLIVAPKVFYFAVGPNSHEVTCPFCKIQAKTTVKRKYLKCYRQHYCSSCGEYLGTFRRPQL

Sequence clustering based on sequence similarity using MMseqs2