Basic Information

Transcription Factor Domain

TF Family: BTB
Domain: zf-C2H2|ZBTB
PFAM: PF00651
TF Group: Zinc-Coordinating Group
Description: The BTB (for BR-C, ttk and bab) [6] or POZ (for Pox virus and Zinc finger) [1] domain is present near the N-terminus of a fraction of zinc finger (Pfam:PF00096) proteins and in proteins that contain the Pfam:PF01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation [1]. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule [2]. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT [5, 3, 4]. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 4.2e-05 0.0053 17.4 0.1 30 71 21 62 5 89 0.79

2 3 0.014 1.7 9.4 0.1 74 106 107 137 102 141 0.83

3 3 4.2 5.4e+02 1.3 0.0 35 64 135 161 133 170 0.78

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	4.2e-05	0.0053	17.4	0.1	30	71	21	62	5	89	0.79
2	3	0.014	1.7	9.4	0.1	74	106	107	137	102	141	0.83
3	3	4.2	5.4e+02	1.3	0.0	35	64	135	161	133	170	0.78

Coding Sequence: ATGGCCAAAATTATGACATTTAAAACGAGtgacaacaaaattttcaaagttgatCTTCAAGTGGCAGTCGTATCAAATGTTATAAAAGAGATGATCAAGCTCCTAGGTGAGGATGAGAATAACGATGAAATTATACCTTTAAACACAATAGATTcagagatttttgaaaaacttctcGAGTGGATGAAATTTCACCAAGATAAACCACATATTGAAATTCCCCCAAAGCAGCAGAAACatatagcatttttaaaaaccgtttcTTTCACAAAAGAAGTCGGTACAGTCATTATACCTAGTTGGGATCTTCAATATTTTcagAAAATTCCCATTGACAAACTAATGGTAGTGTTAGAAGCAGctgaatttttggaaattgaatatttgacGCAACTTATTACCAGCTTCTTTGCAAACCTTATAGACGATAAAATGAAGGCCGATGAAAAGATTCGTTTTGAGAATTTCAAAGCCGAAAAATTTTCCGTTGAAACTATCATTGCGATGCTtgcaaaaaaagattaa
Protein Sequence: MAKIMTFKTSDNKIFKVDLQVAVVSNVIKEMIKLLGEDENNDEIIPLNTIDSEIFEKLLEWMKFHQDKPHIEIPPKQQKHIAFLKTVSFTKEVGTVIIPSWDLQYFQKIPIDKLMVVLEAAEFLEIEYLTQLITSFFANLIDDKMKADEKIRFENFKAEKFSVETIIAMLAKKD

Sequence clustering based on sequence similarity using MMseqs2