Euro005618.1
Basic Information
- Insect
- Eupelmus urozonus
- Gene Symbol
- dl
- Assembly
- GCA_900480035.1
- Location
- UELX01021167.1:1811-2678[+]
Transcription Factor Domain
- TF Family
- RHD
- Domain
- RHD domain
- PFAM
- PF00554
- TF Group
- Beta-Scaffold Factors
- Description
- Proteins containing the Rel homology domain (RHD) are eukaryotic transcription factors. The RHD is composed of two structural domains. This is the N-terminal DNA-binding domain that is similar to that found in P53. The C-terminal domain has an immunoglobulin-like fold (See PF16179) that functions as a dimerisation domain [1-2].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 8.9e-46 2.4e-42 145.3 0.1 1 122 15 138 15 144 0.97
Sequence Information
- Coding Sequence
- atgaatagtaataatactttttacaataatccGAAGCCGTATATTAGAATTGTCGAAGAACCCGGTATCAGACAAACAAGATTTCGATACGAGTGTGAAGGAAGATTTGCTGGAATTATACAAGGAGCTAATAGTACCCCTACAAACAAAACATATCCTTCTATAGAGATTGTAAACCACGCGGGTCCAGCATTCGTCGTTGTGTCTTGCGTCACAAAAGATTCACCTTACCGACCACATCCTCATAATCTTGTAGGCAAATCTAAAGAAGTGTCGCAAGGAATCTGCTATTTTAAAGTACCTGCGCATCAAAAAGTAATAGCTTTCCCGAATCTTGGGATACAGTGCGTCAAAAAGAGAGACATTGGCAAATCGCTTAGGGCAAGAGAACAATTAAAAGTAGATCCTTTTCAAAGTAAGccgGTTTTAGTCATAAAGAACAATTAG
- Protein Sequence
- MNSNNTFYNNPKPYIRIVEEPGIRQTRFRYECEGRFAGIIQGANSTPTNKTYPSIEIVNHAGPAFVVVSCVTKDSPYRPHPHNLVGKSKEVSQGICYFKVPAHQKVIAFPNLGIQCVKKRDIGKSLRAREQLKVDPFQSKPVLVIKNN
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00692677;
- 90% Identity
- iTF_00692677;
- 80% Identity
- -