Eazu025818.1
Basic Information
- Insect
- Eupelmus azureus
- Gene Symbol
- Gcfc2
- Assembly
- GCA_030522685.1
- Location
- JAPYZA010022330.1:1-2351[+]
Transcription Factor Domain
- TF Family
- GCFC
- Domain
- GCFC domain
- PFAM
- PF07842
- TF Group
- Unclassified Structure
- Description
- This entry describes a domain found in a number of GC-rich sequence DNA-binding factor proteins and homologues [4, 5], as well as in a number of other proteins including Tuftelin-interacting protein 11 [1]. While the function of the domain is unknown, some of the proteins it is found in are reported to be involved in pre-mRNA splicing [1, 2]. This domain is also found in Sip1, a septin interacting protein [3].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 8.7e-14 1.8e-09 39.4 0.0 2 50 43 91 42 98 0.94
Sequence Information
- Coding Sequence
- aaaaatatttgtattcatcaatttttaaaaacatcaattttaaaaaattttacattatttacagATGACATTGAAAAGGAGTCCCGAGAACTTTTTATAGATGTAGAAGATGACTTTTCTACAGTTAGATGTATCCTGTCAAAACTTGAAAGTTGGAGGACAACCGATCCAGAATCTTACAACGACGCTTACGTTTCTCTTTGCATTCCAAAAATGATTTCTCCCATAGTTCGTCTTCAACTTATCACGTGGAATCCTATTATGAATCCTAGAAGGGACAACTACTATTTTAAGCCGACGTTTGGTGTACGAAAAATTTAG
- Protein Sequence
- KNICIHQFLKTSILKNFTLFTDDIEKESRELFIDVEDDFSTVRCILSKLESWRTTDPESYNDAYVSLCIPKMISPIVRLQLITWNPIMNPRRDNYYFKPTFGVRKI
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -