Basic Information

Transcription Factor Domain

TF Family: zf-LITAF-like
Domain: zf-LITAF-like domain
PFAM: PF10601
TF Group: Zinc-Coordinating Group
Description: Members of this family display a conserved zinc ribbon structure [3] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS)[2]. The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 1.1 4.4e+03 -1.0 2.8 6 12 17 23 12 31 0.75

2 3 7.8 3.1e+04 -3.7 0.0 3 9 39 45 37 48 0.66

3 3 4.6e-11 1.8e-07 32.3 1.5 2 37 92 127 91 128 0.92

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	1.1	4.4e+03	-1.0	2.8	6	12	17	23	12	31	0.75
2	3	7.8	3.1e+04	-3.7	0.0	3	9	39	45	37	48	0.66
3	3	4.6e-11	1.8e-07	32.3	1.5	2	37	92	127	91	128	0.92

Coding Sequence: ATGTCAAAATTCGAAAATGTCGAACAAAACCTAAGTCGCCGTCGTTGTTGCTCCTGTCCGCAATGCCATCCACCACCCCAATTAGTGTCGATCAGTTCCCATTCGTCCGATGAAACCGTGCAAATTAAATGTCGCCGATCATTGCAAAAGTTACCACCGCGAGAAATACGACCGCCTCATAATGTTGACTGTTCGAAAATGACAAAAGAGGATATGGGGAATTGTCCACTTACTGGGCGTCTATCGCAAACGTTAATCTTTAATCTTGGACCCGGTCCGGTTAACATGATCTGCCCGAATTGCATGTCTCGAATGGAAACGAAGGTGAAGCACAAAGCAAATACCACAACACATGGTGCTGCAATGTGTTTATGTGTTCTACTGTAA
Protein Sequence: MSKFENVEQNLSRRRCCSCPQCHPPPQLVSISSHSSDETVQIKCRRSLQKLPPREIRPPHNVDCSKMTKEDMGNCPLTGRLSQTLIFNLGPGPVNMICPNCMSRMETKVKHKANTTTHGAAMCLCVLL

Sequence clustering based on sequence similarity using MMseqs2