Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 0.0022 22 6.4 0.1 19 52 78 111 73 112 0.86

2 4 1.4e-05 0.14 13.4 0.0 21 52 108 139 106 141 0.89

3 4 0.0047 47 5.3 0.0 21 51 136 166 134 167 0.87

4 4 0.00011 1.2 10.5 0.1 21 47 164 190 160 195 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	0.0022	22	6.4	0.1	19	52	78	111	73	112	0.86
2	4	1.4e-05	0.14	13.4	0.0	21	52	108	139	106	141	0.89
3	4	0.0047	47	5.3	0.0	21	51	136	166	134	167	0.87
4	4	0.00011	1.2	10.5	0.1	21	47	164	190	160	195	0.89

Coding Sequence: ATGACGAATTGTGAGATTGTCATCGTTGCGACTACGGACGAACCGGCAACTGATCTACAAATACCCTTTAACGTCATAACCTCAGCGGCAAATGTATCAGCATCTGGTGTCACGACAACCACTCATCATCTCGCCACACTACAACATAACAACACCGAACAGTTGCAATTACAAACGGACGCACTGCAACAACAAGTGCAGATCGGTCCGCTAACAACGCATCTAAACGCTTCGGGTCCCGAAAAGCCATTCCAGTGCAATGTGTGCGAGCGACGATTTCGACAACTCAGCACGCTTACCAATCACGTGAAGATCCATACCGGCGAGAAACCATACAAATGCACTATCTGCGACAAGACCTTCCGTCAATCGAGCACGCTCACAAATCACATGAAAATACATACGGGCGAGAAACCATTCATCTGTTCCTATTGCCCAAAGAATTTTCGTCAACTAAGCACGCTTACGAATCACCTGAAAATCCATACCGGCGAGAAACCATTCGAATGTGCCGTCTGTAAAAAACAATTCCGCCAATCGAGTACACTCAACAATCACATAAAGATTCATGTGATGGATAAGGTCTATATACCGGTGAAGATCAAGACCGAAGAGGATGAGGGATGA
Protein Sequence: MTNCEIVIVATTDEPATDLQIPFNVITSAANVSASGVTTTTHHLATLQHNNTEQLQLQTDALQQQVQIGPLTTHLNASGPEKPFQCNVCERRFRQLSTLTNHVKIHTGEKPYKCTICDKTFRQSSTLTNHMKIHTGEKPFICSYCPKNFRQLSTLTNHLKIHTGEKPFECAVCKKQFRQSSTLNNHIKIHVMDKVYIPVKIKTEEDEG

Sequence clustering based on sequence similarity using MMseqs2