Edil010949.1
Basic Information
- Insect
- Euglossa dilemma
- Gene Symbol
- Trl_2
- Assembly
- GCA_002201625.1
- Location
- NIJG01000082.1:560043-561967[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 6.2e-20 4.7e-16 58.4 0.0 16 49 10 43 5 48 0.93
Sequence Information
- Coding Sequence
- GAATTAATTTTAGGAGATGGATTGTCCAAAGCACGAAGTATGTCTGATCAACCGGCGTCATGTCCACTTTGTGGAGCAATTTTGCGTCAATCGCGAAATTTAAGGAGGCATTTAGAGCTTCTACATTTTGGTCTCGGTAGCAATAATAAGTCCGGTGTCCACATGAGACACAGAAGAACCGATAGAAATAACGATCTCGTTCGATCGACGCTCGCATCGATTTGTTCACCACATATGACGAGGACGGATTATTCAAGAGCTGTAGAGAGCACTGATTTGTCGACATTAACGTCTTTATCCATTGCTTCGACAGTCAATTCCAGCGCATCGAATGTCAGCCTTGCAGGAAGTTTGATGGGATCAGGTGTACTGGGAACCGGTGATCAAAGCGGGAACTTAGTCTCTGCATCGAGCTCGAACACGGCTTCTATTGCTTCTGCCAATAATGGAATTTACTCGTCAGATGGTAGTGCTAGTATGCTAAATTGCTTATTACCATCGCTACCATCTTTACCTTCTCTGTCTTCTCCGCACGACGTGTTTCGGCATGGTGAAATGTTGCGAGTTGGCATCGCGTACCACGATTCCTCAAGGCAACACCCAAAGCAGTCACAGCGTACCGATGTCACC
- Protein Sequence
- ELILGDGLSKARSMSDQPASCPLCGAILRQSRNLRRHLELLHFGLGSNNKSGVHMRHRRTDRNNDLVRSTLASICSPHMTRTDYSRAVESTDLSTLTSLSIASTVNSSASNVSLAGSLMGSGVLGTGDQSGNLVSASSSNTASIASANNGIYSSDGSASMLNCLLPSLPSLPSLSSPHDVFRHGEMLRVGIAYHDSSRQHPKQSQRTDVT
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01539970; iTF_01424715; iTF_01419974; iTF_01420615; iTF_01421231; iTF_01418684; iTF_00220930; iTF_00226950; iTF_00229030; iTF_00229702; iTF_00224232; iTF_00218091; iTF_00227627; iTF_00216748; iTF_00228334; iTF_00233582; iTF_00221615; iTF_00215377; iTF_00219473; iTF_00222865; iTF_00224913; iTF_00217427; iTF_00230387; iTF_00220151; iTF_00231672; iTF_00223549; iTF_00218782; iTF_00226270; iTF_00216063; iTF_00874129; iTF_00225586; iTF_00983314; iTF_01418057; iTF_00982636; iTF_00118357; iTF_00140944; iTF_00761296; iTF_00361279; iTF_00085839; iTF_00088459; iTF_00089227; iTF_00086776; iTF_00084960;
- 90% Identity
- iTF_00220930;
- 80% Identity
- -