Basic Information

Transcription Factor Domain

TF Family: Fork_head
Domain: Fork_head domain
PFAM: PF00250
TF Group: Helix-turn-helix
Description: The fork head domain is a conserved DNA-binding domain (also known as a winged helix) of about 100 amino-acid residues. Drosophila melanogaster fork head protein is a transcription factor that promotes terminal rather than segmental development, contains neither homeodomains nor zinc-fingers characteristic of other transcription factors [1]. Instead, it contains a distinct type of DNA-binding region, containing around 100 amino acids, which has since been identified in a number of transcription factors (including D. melanogaster FD1-5, mammalian HNF-3, human HTLF, Saccharomyces cerevisiae HCM1, etc.). This is referred to as the fork head domain but is also known as a 'winged helix' [1, 2, 3]. The fork head domain binds B-DNA as a monomer [2], but shows no similarity to previously identified DNA-binding motifs. Although the domain is found in several different transcription factors, a common function is their involvement in early developmental decisions of cell fates during embryogenesis [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 6.4 4.2e+03 -2.9 0.0 20 37 8 26 5 32 0.65

2 3 3.7e-41 2.5e-38 129.2 0.0 1 88 74 168 74 168 0.96

3 3 0.63 4.2e+02 0.3 0.4 18 65 187 233 183 258 0.63

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	6.4	4.2e+03	-2.9	0.0	20	37	8	26	5	32	0.65
2	3	3.7e-41	2.5e-38	129.2	0.0	1	88	74	168	74	168	0.96
3	3	0.63	4.2e+02	0.3	0.4	18	65	187	233	183	258	0.63

Coding Sequence: ATGGAGCCGAATAGGTATCAAAACCATCCTTGCTCGGTATCGAAGATCTACAACTGCGATCTACGTAGAAATTACGAATTATGGAGCACAGAAGAAGCGTTTCCAACAATGTGTCCTTTGCCAAGTTATTATAATTTAGTCCCGGATATATTGAATTCGAGAAACGTGCCTTTCTCATGGGATATTCCGCTGATTAAGTACAAACCTCAGCCACGTTATGAAAAACCACCATATTCGTACATCGCCTTGATAGCCATGGCTATTAATTCTTCGCCTAAACAAAGACTCACACTCTCGGGTATCTACAGATTCATTATGGATAGGTTTCCTTACTACCGAGAAAATCGCCAAGGATGGCAAAATAGTATAAGGCATAATTTAAGCTTAAATGACTGTTTTGTAAAGATAGCGCGAGACAAAGTGGTTGGGAATGATAATGAAGAGGATCAAGCTGGAAAAGGAAGTTACTGGACTTTAGATCCCTCAGCAAGCGAGATGTTTGAACATGGTAATTACAGGAGAAGAAGAATGAGGAAACAACGAGGGTTGGCGCAAGATAAACAGGAACAAAATCGTACAGTAGTTTCGatttcATCGGAGATCTTGTCTActttaaaatataaagaaaaagacGAACAGAGATATGAAACAATTAAAACAAAAAACGTCGCAGAAAATACACGAAACGAGAACATGAAATACACAGAAGGACAAGGACACTGCGTAAAGTCGATGATGTTTACAATCGAGAATATCTTACGAAAATCTACGAACAAATCATCCATTTGA
Protein Sequence: MEPNRYQNHPCSVSKIYNCDLRRNYELWSTEEAFPTMCPLPSYYNLVPDILNSRNVPFSWDIPLIKYKPQPRYEKPPYSYIALIAMAINSSPKQRLTLSGIYRFIMDRFPYYRENRQGWQNSIRHNLSLNDCFVKIARDKVVGNDNEEDQAGKGSYWTLDPSASEMFEHGNYRRRRMRKQRGLAQDKQEQNRTVVSISSEILSTLKYKEKDEQRYETIKTKNVAENTRNENMKYTEGQGHCVKSMMFTIENILRKSTNKSSI

Sequence clustering based on sequence similarity using MMseqs2