Eocu001136.1
Basic Information
- Insect
- Eucriotettix oculatus
- Gene Symbol
- -
- Assembly
- GCA_034510155.1
- Location
- CM067376.1:15884396-15885085[-]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 7 0.22 1.5e+02 3.9 0.1 21 52 32 63 25 65 0.86 2 7 1.3 8.8e+02 1.4 0.1 21 47 60 86 56 93 0.83 3 7 0.12 81 4.7 0.1 21 52 88 119 82 120 0.87 4 7 1.8 1.2e+03 1.0 0.0 21 47 116 142 113 147 0.83 5 7 0.07 47 5.5 0.0 21 47 144 170 133 175 0.83 6 7 0.011 7.4 8.1 0.0 21 48 172 199 168 203 0.87 7 7 0.019 13 7.3 0.0 21 46 200 225 196 227 0.91
Sequence Information
- Coding Sequence
- ATGTACACTGGTGATAAACTTTACAAATGTGTcgaatgtgataaaatattcacaggGTCCTCATACTTATCAAAGCACATGAGGACTcatactggtgagaaaccattcaaatgtgttgagtgtgactTATCATTCACACAATCCTCACACTTAACATGCCActtgaggattcacactggtgagaaaccatacaaatgtgttgagtgcaATAAGACATTCTCAAATTCCTCAATCTTAAGAAATCACAAGAGgtttcacactggtgagaagccatacaTATGTGTAGAGTGCAATAAAACATTCACACTATCCACACATTTAACACGCCActtgaggattcacactggtgagaagccatacaaatgtgttgagtgcaATAAAACATTCACACTCTCCACTCATTTAACACGTCATtcgaggattcacactggtgagaagccatacaaatgtgttgagtgtggtaAAATATTTGCACAGTCCTCGGACTTGTCAAATCACATGAGGTTTCACACTGGagagaagccatacaaatgtgttgagtgtgataaagtATTTGCACAGTCCTCGGATTTATCAAAGcatatgagaattcacactggtgaaaagccatacaagtGTGGTgtatgtgataaaacattcacaCAGTCCTCACATTTAACAAATCATTTGAGGATTCATACTGATGAATAA
- Protein Sequence
- MYTGDKLYKCVECDKIFTGSSYLSKHMRTHTGEKPFKCVECDLSFTQSSHLTCHLRIHTGEKPYKCVECNKTFSNSSILRNHKRFHTGEKPYICVECNKTFTLSTHLTRHLRIHTGEKPYKCVECNKTFTLSTHLTRHSRIHTGEKPYKCVECGKIFAQSSDLSNHMRFHTGEKPYKCVECDKVFAQSSDLSKHMRIHTGEKPYKCGVCDKTFTQSSHLTNHLRIHTDE
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00678880;
- 90% Identity
- iTF_00678880;
- 80% Identity
- iTF_00678880;