Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.00019 0.13 13.7 0.1 21 51 6 36 2 38 0.86

2 7 5 3.4e+03 -0.4 0.0 22 45 35 58 31 66 0.78

3 7 6.5 4.4e+03 -0.8 0.0 22 44 63 85 55 88 0.80

4 7 1.6 1.1e+03 1.1 0.0 26 46 116 136 107 143 0.80

5 7 0.84 5.7e+02 2.0 0.0 21 44 139 162 135 166 0.87

6 7 0.015 10 7.6 0.0 21 44 167 190 162 194 0.91

7 7 0.66 4.5e+02 2.4 0.0 21 43 195 217 192 224 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.00019	0.13	13.7	0.1	21	51	6	36	2	38	0.86
2	7	5	3.4e+03	-0.4	0.0	22	45	35	58	31	66	0.78
3	7	6.5	4.4e+03	-0.8	0.0	22	44	63	85	55	88	0.80
4	7	1.6	1.1e+03	1.1	0.0	26	46	116	136	107	143	0.80
5	7	0.84	5.7e+02	2.0	0.0	21	44	139	162	135	166	0.87
6	7	0.015	10	7.6	0.0	21	44	167	190	162	194	0.91
7	7	0.66	4.5e+02	2.4	0.0	21	43	195	217	192	224	0.89

Coding Sequence: atgaggactcacacgggtgaaaagccatacaaatgcgTAGAATGCGATCAAGTATTCTCGCAATCATCAAACTTGAGAACACACATGAgggttcacactggtgagaagccgTACAAATGTGCGGAGTGTAAAGTGGCGTTTTCACACTTGGCAAACTTGACAGtgcacatgaggactcacaccgGTAAGAAGCCATACCATtgtgtcgagtgtgataaaacattctcgcAATCCACAAAATTAGCCATTCATATGAGGACGCACAATGGTGATGATTCTGTTGTGCGCGACAAAACGTTCTCAAGGTTGCCAGGTTTATCAAATCAGATGGGAACACGCGCATACCAATGTTTTGAGTGCGACAAAGTGTTCTATAGATCCTCAAACTTAACCAGCCACATGCGGACTCACAccggtgaaaagccatacaagtGTGGCCAGTGTGATAAAGCATTCTCACAATccacaaaattaacaattcatatGAGGAcccacactggtgaaaagccatacaaatgcgCAGAGTGCGGTAAAGTATTCTCAGTTTCCTCGACATTAAGACGTCACATATGGACGCACACCGGTGAGAAACCGTACAAATGTGTCGACTGTGGTAAAGAATTCTCAGATTCCTCAACGTTAAGGAGGCACAAGAGTTCTCACAGCCGAAAAACCATTCCCATGTGTTAA
Protein Sequence: MRTHTGEKPYKCVECDQVFSQSSNLRTHMRVHTGEKPYKCAECKVAFSHLANLTVHMRTHTGKKPYHCVECDKTFSQSTKLAIHMRTHNGDDSVVRDKTFSRLPGLSNQMGTRAYQCFECDKVFYRSSNLTSHMRTHTGEKPYKCGQCDKAFSQSTKLTIHMRTHTGEKPYKCAECGKVFSVSSTLRRHIWTHTGEKPYKCVDCGKEFSDSSTLRRHKSSHSRKTIPMC

Sequence clustering based on sequence similarity using MMseqs2