Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 0.014 9.5 7.7 0.0 21 47 6 32 3 37 0.86

2 8 0.056 38 5.8 0.1 21 48 34 61 31 66 0.86

3 8 0.26 1.8e+02 3.7 0.0 21 52 62 93 59 95 0.87

4 8 2.2 1.5e+03 0.7 0.1 22 52 91 121 86 122 0.80

5 8 0.52 3.5e+02 2.7 0.0 23 51 145 173 139 175 0.84

6 8 2.4 1.6e+03 0.6 0.0 21 47 171 197 160 202 0.77

7 8 0.31 2.1e+02 3.4 0.0 21 52 199 230 193 231 0.87

8 8 0.053 36 5.9 0.0 22 46 228 252 225 254 0.90

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	0.014	9.5	7.7	0.0	21	47	6	32	3	37	0.86
2	8	0.056	38	5.8	0.1	21	48	34	61	31	66	0.86
3	8	0.26	1.8e+02	3.7	0.0	21	52	62	93	59	95	0.87
4	8	2.2	1.5e+03	0.7	0.1	22	52	91	121	86	122	0.80
5	8	0.52	3.5e+02	2.7	0.0	23	51	145	173	139	175	0.84
6	8	2.4	1.6e+03	0.6	0.0	21	47	171	197	160	202	0.77
7	8	0.31	2.1e+02	3.4	0.0	21	52	199	230	193	231	0.87
8	8	0.053	36	5.9	0.0	22	46	228	252	225	254	0.90

Coding Sequence: atgaggattcatacaggtgaaaagccattcaaatgtgtagagtgtgatacTACATTCTCACAATCAGGTTCTTTGAAGCGACATATGatgattcatacaggtgaaaagccatttaaatgtgttgagtgttgtGCAACTTTCTCACAATTAGGTCATCTGAGACAACACATAatgattcacacaggtgaaaagccttttaaatgtgttgagtgtggaATTGCATTTTCACAATCAGCTCATCTAACAACCCATTTAAAGAGCCATACTTGTGACAAACCATAtaattgtgttgagtgtgatacaaCATTCTCACGATTAGGTTCGCTGAGAaaacacatgagaattcatacAGGAGGAAAACCATTTGAATGTGATACCACATTTTCATTGTCATGTTCTCCCCCAAATCACGTGAGGGTTCATAGAGATTTAAAACCATTCCGATGTGTTGAATGTGACACCACATTCTCAGAATCAGGTTCTTTAAAaagacacatgaggattcacacaggtgaaaagccatttaaatgcgCAGAATGTGAGACTGCTTTCTCCCTGTCAAGTTCCCTAACAACtcacatgagaattcatactggtgaaaagccattcaaatgtgtGGAGTGTGAGGCTGCATTCTCACGATCTGGCCACCTAACAAACCACATGAAGATTCATACTGGTGacaaaccatacaaatgtgttgaatgttatAAATCATTCTCTGTGTCAAGCAGCCTAAAGAGGCATGTGaagattcacactggtgaaactACATAA
Protein Sequence: MRIHTGEKPFKCVECDTTFSQSGSLKRHMMIHTGEKPFKCVECCATFSQLGHLRQHIMIHTGEKPFKCVECGIAFSQSAHLTTHLKSHTCDKPYNCVECDTTFSRLGSLRKHMRIHTGGKPFECDTTFSLSCSPPNHVRVHRDLKPFRCVECDTTFSESGSLKRHMRIHTGEKPFKCAECETAFSLSSSLTTHMRIHTGEKPFKCVECEAAFSRSGHLTNHMKIHTGDKPYKCVECYKSFSVSSSLKRHVKIHTGETT

Sequence clustering based on sequence similarity using MMseqs2