Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 1 6.9e+02 1.8 0.1 23 46 8 31 4 37 0.82

2 8 0.0087 5.9 8.4 0.1 22 51 35 64 30 65 0.85

3 8 0.0054 3.7 9.0 0.1 22 52 63 93 60 94 0.87

4 8 0.072 49 5.4 0.1 23 48 92 117 88 122 0.81

5 8 0.53 3.6e+02 2.7 0.3 23 45 123 142 117 149 0.66

6 8 0.00068 0.46 11.9 0.1 22 52 147 177 142 178 0.86

7 8 0.0032 2.2 9.8 0.4 22 52 175 205 172 207 0.87

8 8 1.3 9e+02 1.4 0.3 23 46 204 227 200 233 0.75

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	1	6.9e+02	1.8	0.1	23	46	8	31	4	37	0.82
2	8	0.0087	5.9	8.4	0.1	22	51	35	64	30	65	0.85
3	8	0.0054	3.7	9.0	0.1	22	52	63	93	60	94	0.87
4	8	0.072	49	5.4	0.1	23	48	92	117	88	122	0.81
5	8	0.53	3.6e+02	2.7	0.3	23	45	123	142	117	149	0.66
6	8	0.00068	0.46	11.9	0.1	22	52	147	177	142	178	0.86
7	8	0.0032	2.2	9.8	0.4	22	52	175	205	172	207	0.87
8	8	1.3	9e+02	1.4	0.3	23	46	204	227	200	233	0.75

Coding Sequence: ATGAGAATACACACTGGACAAAAACCTTACCAGTGTACAGAGTGCAATGTATATTTTAGTCGATCTGGATCATTAAATAGGCACATGAGAACTCATACTGGACAGAAACCTTATCAGTGTACAGAATGTGAAGCATCTTTTAGCCAGTCTGGACATTTAACCAGGCACATGAAAATTCATACTGGTCAGAAACCATACCAATGTCCAGAGTGTGAGGCATTTTTTAGTGAGTCAGCATATTTAACgagacacatgagaattcatactGGACAAAAGCCATATCAGTGCTCAACATGTCAAATATCTTTTAGTCAATCAGGAGACTTAACCAGACATAAGAGAATTCACACTGGACAGAAACCTTATCAGTGTGCAGAATGTGAAGTATGTTTCAGccggtctgaaaatttaactgctCATATGAGAAACCACACAGGACAGAAACCATATCAGTGTCCGGTTTGTGAAATACCATTCAGTCAATCTGGAGACCTAACCaggcacatgaggattcatactgggCAGAAACCTTATCAGTGTCCAAATTGTGACGTGTCTTTTAGACAGTCTGCACATTTAACTGCtcacatgagaattcatactGGACAGAAACCATACCAGTGTTCAGAATGTAATGTGTGTTTCAGTCGGTCTGGATCTTTGAACAGGCACAAAAGAATGCATACTGTGCCAAAAGCTAGTCAGTATATAGGCTACAAAGAAACTTTCAGGCAATACGAGCACTTAacatga
Protein Sequence: MRIHTGQKPYQCTECNVYFSRSGSLNRHMRTHTGQKPYQCTECEASFSQSGHLTRHMKIHTGQKPYQCPECEAFFSESAYLTRHMRIHTGQKPYQCSTCQISFSQSGDLTRHKRIHTGQKPYQCAECEVCFSRSENLTAHMRNHTGQKPYQCPVCEIPFSQSGDLTRHMRIHTGQKPYQCPNCDVSFRQSAHLTAHMRIHTGQKPYQCSECNVCFSRSGSLNRHKRMHTVPKASQYIGYKETFRQYEHLT

Sequence clustering based on sequence similarity using MMseqs2