Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 1.2 8.3e+02 1.5 0.0 21 44 8 31 2 37 0.86

2 10 0.0089 6 8.4 0.0 23 52 38 67 31 71 0.87

3 10 3.3 2.2e+03 0.1 0.0 22 44 65 87 62 91 0.87

4 10 0.013 8.9 7.8 0.1 21 45 92 116 84 123 0.88

5 10 0.31 2.1e+02 3.4 0.0 21 45 120 144 115 152 0.86

6 10 2.1 1.4e+03 0.8 0.0 21 45 148 172 143 180 0.78

7 10 0.081 55 5.3 0.1 17 45 172 200 165 207 0.85

8 10 0.059 40 5.7 0.0 21 44 204 227 199 235 0.84

9 10 0.097 66 5.0 0.1 20 51 231 262 224 264 0.80

10 10 9 6.1e+03 -1.3 0.0 21 46 260 285 256 291 0.79

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	1.2	8.3e+02	1.5	0.0	21	44	8	31	2	37	0.86
2	10	0.0089	6	8.4	0.0	23	52	38	67	31	71	0.87
3	10	3.3	2.2e+03	0.1	0.0	22	44	65	87	62	91	0.87
4	10	0.013	8.9	7.8	0.1	21	45	92	116	84	123	0.88
5	10	0.31	2.1e+02	3.4	0.0	21	45	120	144	115	152	0.86
6	10	2.1	1.4e+03	0.8	0.0	21	45	148	172	143	180	0.78
7	10	0.081	55	5.3	0.1	17	45	172	200	165	207	0.85
8	10	0.059	40	5.7	0.0	21	44	204	227	199	235	0.84
9	10	0.097	66	5.0	0.1	20	51	231	262	224	264	0.80
10	10	9	6.1e+03	-1.3	0.0	21	46	260	285	256	291	0.79

Coding Sequence: ATGAACAGGAGGACCCACACTGGTgataaaccatataaatgttccgagtgtgataaaaaattctcaCGATCCTCAAACTTATCAAAACATATGACGAGTCACTCTGGTGTAAGACCTTACGAATGTGTAGAGTGTTACTCAGCTTTCTCACAATTCGCAAGCttaaaaaaacacttaaaaatcCACACTGGTGACAAACCATATGtatgtgtcgagtgtgataaaacattctcgcAGTACTCGGACTTAGCAAGGCACATGAGGAcccacactggtgaaaagccatataaatgtgttttgtGCAGTAAAACATTCACTCAATCCTCAAACTTGGCAAgccacatgaggactcacactggtgaaagaCCGTACAAATGTGTTGcatgtgataaaacattctcaaaatCATCAAACTTAAATGATCACATGAGGAGTCACACaggtgagaaaccatataattgtgttgaatgtgataaaacattctcactaTCCTCGGACTTAACAAAACACATGAGAcgtcacactggtgagaaaccgtATAAATGTTTAGAGtgttgtaaaacattttcacaatcctCAGATTTAGCAAAGCACGTGAGGACTCActctggtgaaaaaccatataaatgtgatGAGTGTTACAAGGCATTCTCTCAAACCTCCATCTTAAAAAAGCACAAGAGAACTCActctggtgaaaaaccatataaatgcGTTGAGTGTGATACAACATTTTCACAATCGTCACACTTAACAagccacatgaggattcacactggtgagaaaccatataaatgtgctgaatgtgataaaacattctcacttTCCAAAACCTTGGTAGGTCATATCAAGACTCACAGTTATGAGGAACCATACAAATGTTAA
Protein Sequence: MNRRTHTGDKPYKCSECDKKFSRSSNLSKHMTSHSGVRPYECVECYSAFSQFASLKKHLKIHTGDKPYVCVECDKTFSQYSDLARHMRTHTGEKPYKCVLCSKTFTQSSNLASHMRTHTGERPYKCVACDKTFSKSSNLNDHMRSHTGEKPYNCVECDKTFSLSSDLTKHMRRHTGEKPYKCLECCKTFSQSSDLAKHVRTHSGEKPYKCDECYKAFSQTSILKKHKRTHSGEKPYKCVECDTTFSQSSHLTSHMRIHTGEKPYKCAECDKTFSLSKTLVGHIKTHSYEEPYKC

Sequence clustering based on sequence similarity using MMseqs2