Eocu000409.1
Basic Information
- Insect
- Eucriotettix oculatus
- Gene Symbol
- -
- Assembly
- GCA_034510155.1
- Location
- CM067376.1:3898665-3899264[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 5 0.028 19 6.8 0.0 21 52 30 61 21 61 0.84 2 5 0.18 1.3e+02 4.1 0.1 21 44 58 81 56 85 0.79 3 5 0.016 11 7.5 0.1 21 46 86 111 75 117 0.86 4 5 0.03 21 6.7 0.0 20 52 141 173 132 174 0.80 5 5 0.00035 0.24 12.9 0.6 21 46 170 195 166 198 0.91
Sequence Information
- Coding Sequence
- ATGGGtgaaaaaccattcaaatgttGCGAGTGTGACCAAAACTTTTCTAAATTAAGTCACTTAAAAATTCACACAAGGGTTCACAGTGGTGAAAAGCCTTACAGTTGTTGTGAATGTGGCAAAAGTTTCTCAGAATCGGGCAGTTTAAAAAAGCACTTGAGgcttcacacaggtgaaaaaccatacacaTGTGGTGAATGTTACAAAAGATTCTCTGAATTAGGTAGTTTAAAAAGCCACATGAGGGTTCACACTGGCGAGAAGCCATTCACATGCTGCGAGTGTGACTTCAAGTTCTCTCGATCAGATAGTTTGAGAAATCACATGAGGCTTCACATCGGTGAAAAGTCATACGCATGTTGCGAGTGTGACCAAAAATTCTCtaaattatctcatttaaaaaatcactcGAGGATTCATACTGGCGAGAAGCCATACGAATGCTGTGAATGTGGTAAAAAGTTCTCTGAATCAGGCAATTTGAAAaagcacatgaggattcacacaggtgaaaaaccatacacaTGTAGTAAATGTTGTAAAAGATTCTCCGATTCACGTACTTTAAAAAGGCACCTGAGGGTTCACAATGCAGTGTAG
- Protein Sequence
- MGEKPFKCCECDQNFSKLSHLKIHTRVHSGEKPYSCCECGKSFSESGSLKKHLRLHTGEKPYTCGECYKRFSELGSLKSHMRVHTGEKPFTCCECDFKFSRSDSLRNHMRLHIGEKSYACCECDQKFSKLSHLKNHSRIHTGEKPYECCECGKKFSESGNLKKHMRIHTGEKPYTCSKCCKRFSDSRTLKRHLRVHNAV
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00678935;
- 90% Identity
- iTF_00678935;
- 80% Identity
- iTF_00678935;