Eocu000190.1
Basic Information
- Insect
- Eucriotettix oculatus
- Gene Symbol
- -
- Assembly
- GCA_034510155.1
- Location
- CM067376.1:1549714-1550277[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 6 6.8 4.6e+03 -0.9 0.0 22 44 7 29 5 37 0.78 2 6 0.26 1.8e+02 3.7 0.0 20 51 33 64 22 66 0.81 3 6 0.66 4.5e+02 2.4 0.0 21 45 62 86 58 89 0.88 4 6 0.0029 2 9.9 0.0 22 49 91 118 87 121 0.85 5 6 0.0096 6.5 8.3 0.0 21 51 118 148 114 150 0.87 6 6 0.018 12 7.4 0.1 21 52 146 177 142 179 0.89
Sequence Information
- Coding Sequence
- atgaggattcatacggGTGAGAAGCCGTTTAAATGCGGCGAGTGTCTCAAGTCATTCACAACATCAAGCCACTTAAAAGTACATTCGAGGTTTCATACGGGCGAGAAGCCGTTTAAGTGTGTCGAGTGTCTCAAGTCATTCGCAACGTCAAGTCAATTGAAAGTACATTTGAGGGTTCACACAGGTGAGAAGCCGTTTAAGTGTGGCGAGTGTGACGTGTCATTCACACAATCGTCCCAGCTGACAatacacatgagaattcacaccggtgataatccatttaaatgtgttgagtgtttcaAGTTATTCAGAGCGTCAGCCAATCTAAAAACACACATGAGTATTCATACAGGCGAAAAGCCGTTTACATGCGTCGAGTGCGGTACGTCGTTCACGCAGTTGTCTAACCTAACaaaacacatgaggattcacactggcgaAAAGCCATTTGAATGTGCAGCGTGTTTCAAATCATTTAAACGGTCAAGTTCTCTAAAATTACACATGAGGACCCACACAGTTGAAAAGCCATTGGTGAGTGAGATAATATATCATTCAAACTAG
- Protein Sequence
- MRIHTGEKPFKCGECLKSFTTSSHLKVHSRFHTGEKPFKCVECLKSFATSSQLKVHLRVHTGEKPFKCGECDVSFTQSSQLTIHMRIHTGDNPFKCVECFKLFRASANLKTHMSIHTGEKPFTCVECGTSFTQLSNLTKHMRIHTGEKPFECAACFKSFKRSSSLKLHMRTHTVEKPLVSEIIYHSN
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00678926;
- 90% Identity
- iTF_00678926;
- 80% Identity
- iTF_00678926;