Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 6.8 4.6e+03 -0.9 0.0 22 44 7 29 5 37 0.78

2 6 0.26 1.8e+02 3.7 0.0 20 51 33 64 22 66 0.81

3 6 0.66 4.5e+02 2.4 0.0 21 45 62 86 58 89 0.88

4 6 0.0029 2 9.9 0.0 22 49 91 118 87 121 0.85

5 6 0.0096 6.5 8.3 0.0 21 51 118 148 114 150 0.87

6 6 0.018 12 7.4 0.1 21 52 146 177 142 179 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	6.8	4.6e+03	-0.9	0.0	22	44	7	29	5	37	0.78
2	6	0.26	1.8e+02	3.7	0.0	20	51	33	64	22	66	0.81
3	6	0.66	4.5e+02	2.4	0.0	21	45	62	86	58	89	0.88
4	6	0.0029	2	9.9	0.0	22	49	91	118	87	121	0.85
5	6	0.0096	6.5	8.3	0.0	21	51	118	148	114	150	0.87
6	6	0.018	12	7.4	0.1	21	52	146	177	142	179	0.89

Coding Sequence: atgaggattcatacggGTGAGAAGCCGTTTAAATGCGGCGAGTGTCTCAAGTCATTCACAACATCAAGCCACTTAAAAGTACATTCGAGGTTTCATACGGGCGAGAAGCCGTTTAAGTGTGTCGAGTGTCTCAAGTCATTCGCAACGTCAAGTCAATTGAAAGTACATTTGAGGGTTCACACAGGTGAGAAGCCGTTTAAGTGTGGCGAGTGTGACGTGTCATTCACACAATCGTCCCAGCTGACAatacacatgagaattcacaccggtgataatccatttaaatgtgttgagtgtttcaAGTTATTCAGAGCGTCAGCCAATCTAAAAACACACATGAGTATTCATACAGGCGAAAAGCCGTTTACATGCGTCGAGTGCGGTACGTCGTTCACGCAGTTGTCTAACCTAACaaaacacatgaggattcacactggcgaAAAGCCATTTGAATGTGCAGCGTGTTTCAAATCATTTAAACGGTCAAGTTCTCTAAAATTACACATGAGGACCCACACAGTTGAAAAGCCATTGGTGAGTGAGATAATATATCATTCAAACTAG
Protein Sequence: MRIHTGEKPFKCGECLKSFTTSSHLKVHSRFHTGEKPFKCVECLKSFATSSQLKVHLRVHTGEKPFKCGECDVSFTQSSQLTIHMRIHTGDNPFKCVECFKLFRASANLKTHMSIHTGEKPFTCVECGTSFTQLSNLTKHMRIHTGEKPFECAACFKSFKRSSSLKLHMRTHTVEKPLVSEIIYHSN

Sequence clustering based on sequence similarity using MMseqs2