Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 0.11 74 4.9 0.0 21 52 6 37 3 39 0.88

2 9 0.51 3.5e+02 2.7 0.0 21 52 34 65 32 67 0.87

3 9 0.24 1.7e+02 3.8 0.0 21 51 62 92 51 94 0.85

4 9 0.38 2.6e+02 3.1 0.1 21 44 90 113 86 117 0.89

5 9 0.015 9.9 7.7 0.1 21 47 118 144 115 151 0.86

6 9 7.1 4.8e+03 -0.9 0.0 22 43 147 168 144 177 0.69

7 9 0.15 1e+02 4.4 0.0 21 48 174 201 168 205 0.86

8 9 0.046 31 6.1 0.1 21 52 202 233 198 234 0.88

9 9 0.056 38 5.8 0.0 21 48 230 257 228 260 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	0.11	74	4.9	0.0	21	52	6	37	3	39	0.88
2	9	0.51	3.5e+02	2.7	0.0	21	52	34	65	32	67	0.87
3	9	0.24	1.7e+02	3.8	0.0	21	51	62	92	51	94	0.85
4	9	0.38	2.6e+02	3.1	0.1	21	44	90	113	86	117	0.89
5	9	0.015	9.9	7.7	0.1	21	47	118	144	115	151	0.86
6	9	7.1	4.8e+03	-0.9	0.0	22	43	147	168	144	177	0.69
7	9	0.15	1e+02	4.4	0.0	21	48	174	201	168	205	0.86
8	9	0.046	31	6.1	0.1	21	52	202	233	198	234	0.88
9	9	0.056	38	5.8	0.0	21	48	230	257	228	260	0.89

Coding Sequence: atgaggattcacacaggtgaaaaaccatataaatgtgtcaAGTGCACAAAAAGTTTTTCTCAGTTAAGTAGTCTAAAAAGGCACATAAatattcacacaggtgaaaagccatataaCTGTACTGAGTGTGATACAACATTTACTCGATCTGGACACCTAAAAaatcacatgaggattcacactggtgaaaagccatataaATGTGGTGGCTGTGATAAAGCATTCACACAATCCAGTGCCCTAACAAACCACATGAGGATCCACACTGgagaaaagccatacaaatgtattGAGTGTAATGCAACATTCACTCAATTAAGCAATTTAACAACTCATGCTATGATTCATAGTGGTGAAAAGCCATATATATGCGGTGCATGTAATAGAACATTCTCACAATCTAGTCACCTAACAAGACACATGATgtttcacacaggtgaaaagccatataaATGTAGTATGTGCCAGAAAACGTACTCAGGATTTGCTGCTTTAAAACTTCATATGAGAATTCATACAgatgaaaaaccatacaaatgtctTGAGTGTGATAAAGCATTCTCACAATCATCTGATTTAACGaagcacatgaggattcacactggggaaaaaccatacaaatgtgttgtgtGTACAAAAGCTTTCTCACAATCAAGTATTCTAAATACTCACATGAagattcatactggtgaaaagcccCACAAATGTGATGTGTGTGGCAAGGGATTCTCCCGATCCAGTTATTTAAGAAATCACTTAGTAAAAAGTCATACAAATGTCCAGAGTGAGATAGGACAGcagaagataattaaataa
Protein Sequence: MRIHTGEKPYKCVKCTKSFSQLSSLKRHINIHTGEKPYNCTECDTTFTRSGHLKNHMRIHTGEKPYKCGGCDKAFTQSSALTNHMRIHTGEKPYKCIECNATFTQLSNLTTHAMIHSGEKPYICGACNRTFSQSSHLTRHMMFHTGEKPYKCSMCQKTYSGFAALKLHMRIHTDEKPYKCLECDKAFSQSSDLTKHMRIHTGEKPYKCVVCTKAFSQSSILNTHMKIHTGEKPHKCDVCGKGFSRSSYLRNHLVKSHTNVQSEIGQQKIIK

Sequence clustering based on sequence similarity using MMseqs2