Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 0.27 1.8e+02 3.6 0.0 21 52 6 37 3 39 0.87

2 10 1.5 1e+03 1.2 0.0 21 45 34 58 31 65 0.85

3 10 0.011 7.2 8.1 0.0 21 50 62 91 55 93 0.85

4 10 0.0077 5.2 8.6 0.1 21 52 90 121 88 123 0.87

5 10 0.86 5.8e+02 2.0 0.1 21 51 118 148 114 150 0.86

6 10 0.12 81 4.7 0.1 21 51 146 176 132 179 0.83

7 10 1.3 8.9e+02 1.4 0.0 22 48 175 201 162 205 0.80

8 10 0.0052 3.5 9.1 0.1 21 48 202 229 193 233 0.84

9 10 0.018 12 7.4 0.0 21 52 230 261 226 263 0.90

10 10 0.76 5.1e+02 2.2 0.1 21 44 258 281 256 285 0.87

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	0.27	1.8e+02	3.6	0.0	21	52	6	37	3	39	0.87
2	10	1.5	1e+03	1.2	0.0	21	45	34	58	31	65	0.85
3	10	0.011	7.2	8.1	0.0	21	50	62	91	55	93	0.85
4	10	0.0077	5.2	8.6	0.1	21	52	90	121	88	123	0.87
5	10	0.86	5.8e+02	2.0	0.1	21	51	118	148	114	150	0.86
6	10	0.12	81	4.7	0.1	21	51	146	176	132	179	0.83
7	10	1.3	8.9e+02	1.4	0.0	22	48	175	201	162	205	0.80
8	10	0.0052	3.5	9.1	0.1	21	48	202	229	193	233	0.84
9	10	0.018	12	7.4	0.0	21	52	230	261	226	263	0.90
10	10	0.76	5.1e+02	2.2	0.1	21	44	258	281	256	285	0.87

Coding Sequence: atgaggattcatactggtgagaagccatacaaatgtgttgagtgtgataaagccTTCTCACAATCCTCACACTTAACACAGCACATGAGGATACATACTGGTGAGAAaccttttaaatgtgttgagtgcgAAACAATATTCTCAAGATCTTCAGGCCTAATCAAGCACATGAGGACTCAtactggtgagaagccataccaatgtgttgagtgtgataaagccTTCTCACAATCCTCAAACTTAACAGAGCActtgaggattcacactggtgaaaaaccatacaaatgtgttgaatgtgttgcaaTATTCACACGGTCCTCAGACTTAATAAGGCACATaaggattcatactggtgagaagccatacaaCTGTGTTGAGTGTcataaaacattctcaaaatCCTCACACTTAACagaacacatgaggattcatactggcGAGAAGCCATACCAATGTGttgtgtgtgataaaacattcacaCGGTCCTCAGAATTACCAAAGCACATGAGAGTTCATAGTGGTaagaagccatacaaatgtgttgagtgtaataaaacattttcacaatcctCAGTCTTAACAGAGCACATGAGGATACACACCGGTGAGAAGCCcttcaaatgtgttgaatgttatAAAGCATTCTCACAATCTTCACACTTAACACAGCACATaaggattcatactggtgagaagccatataaatgtgttgagtgtgatacagTATTCACACGGTCTTCAGACTTAACAAAGCATATGAGGCTTcatactggtgagaaaccatacaaatgtgttgagtgtaataaaacattttcacaatcctCTATTTTATCGAAGCACATGAGGCATCATACTGGTTAG
Protein Sequence: MRIHTGEKPYKCVECDKAFSQSSHLTQHMRIHTGEKPFKCVECETIFSRSSGLIKHMRTHTGEKPYQCVECDKAFSQSSNLTEHLRIHTGEKPYKCVECVAIFTRSSDLIRHIRIHTGEKPYNCVECHKTFSKSSHLTEHMRIHTGEKPYQCVVCDKTFTRSSELPKHMRVHSGKKPYKCVECNKTFSQSSVLTEHMRIHTGEKPFKCVECYKAFSQSSHLTQHIRIHTGEKPYKCVECDTVFTRSSDLTKHMRLHTGEKPYKCVECNKTFSQSSILSKHMRHHTG

Sequence clustering based on sequence similarity using MMseqs2