Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 3.8 2.6e+03 -0.1 0.0 26 48 9 31 4 35 0.81

2 10 0.54 3.6e+02 2.7 0.0 21 48 32 59 24 63 0.84

3 10 0.4 2.7e+02 3.1 0.0 21 52 60 91 56 93 0.87

4 10 0.068 46 5.5 0.1 21 52 88 119 83 119 0.88

5 10 0.0017 1.1 10.7 0.0 21 49 116 144 112 147 0.85

6 10 0.0068 4.6 8.7 0.0 22 48 145 171 142 175 0.87

7 10 0.21 1.4e+02 4.0 0.0 21 47 172 198 169 203 0.85

8 10 0.74 5e+02 2.2 0.0 21 45 200 224 197 230 0.90

9 10 7.7 5.2e+03 -1.1 0.0 22 47 229 254 225 259 0.77

10 10 0.033 22 6.5 0.0 21 52 256 287 251 289 0.87

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	3.8	2.6e+03	-0.1	0.0	26	48	9	31	4	35	0.81
2	10	0.54	3.6e+02	2.7	0.0	21	48	32	59	24	63	0.84
3	10	0.4	2.7e+02	3.1	0.0	21	52	60	91	56	93	0.87
4	10	0.068	46	5.5	0.1	21	52	88	119	83	119	0.88
5	10	0.0017	1.1	10.7	0.0	21	49	116	144	112	147	0.85
6	10	0.0068	4.6	8.7	0.0	22	48	145	171	142	175	0.87
7	10	0.21	1.4e+02	4.0	0.0	21	47	172	198	169	203	0.85
8	10	0.74	5e+02	2.2	0.0	21	45	200	224	197	230	0.90
9	10	7.7	5.2e+03	-1.1	0.0	22	47	229	254	225	259	0.77
10	10	0.033	22	6.5	0.0	21	52	256	287	251	289	0.87

Coding Sequence: ATGAACACTGGTGAAAATTTTTACAACTGTGTTGAGTGTcataaaacattctcacaatCCTCACATTTAACAgagcacatgaggattcacactggtgagaagccattcAAATGTATTGAGTGTGATGCAAAATTCACACGGTCCTCAGAATTAATAAAgcacatgagaattcatactggtgagaagccatacaaatgtgttgagtgtgatacaaCATTTACATCATCCTCAGGCCTAACAaggcacatgaggattcatactggtgagaaaccatacaaatgtgttgactGTGATAGAACATTTTCACAATCGTCAACCTTAACACGGCACATCAAGACTCACACtgttgagaaaccatacaaatgtgttgagtgtgctAAAATATTCAGACAATCCTCAGACTTATCAaagcacatgaggattcactttggtgaaaaaccatacaagtgTGGTGAGTGTTATACAACATTCTCAGAATCTTCACTCTTAACACGCCACTTGAGgtttcacactggtgagaaaccatacaaatgtgttgaatgttatAAAGCATTCCCCAAATCCTCAAGTTTAACAACCCACATGAgggttcacactggtgagaaaccatacaaatgtgttgagtgtgataaattaTTCACCAAGTCATCTTCCTTATCAAGACACATGActactcacactggtgagaagtctcacaaatgtgttgaatgttatAAAGCATTCTCACAATTGCCTCAGTTAATAtgccacatgaggattcacactggtgagaaaccatacaagtgtgttgaatgtaataaaacattctccCAATCCTCTAACTTAACAgcccacatgaggattcatactggtgagaaaccatacaaatgtattgaatgtgataaaacattctcacagTTGTCCCATTTAACAGGTCACATGAAGACTCATTCTGTTTTGAAACCATACAAATCTGCTGAGTGTGACAAatcagtttcaaatttttcaaactCATCAACCCACATGAGGACTCTCACTGGTGAGAAATTTGTTGAGTGTAAGAAAATATAG
Protein Sequence: MNTGENFYNCVECHKTFSQSSHLTEHMRIHTGEKPFKCIECDAKFTRSSELIKHMRIHTGEKPYKCVECDTTFTSSSGLTRHMRIHTGEKPYKCVDCDRTFSQSSTLTRHIKTHTVEKPYKCVECAKIFRQSSDLSKHMRIHFGEKPYKCGECYTTFSESSLLTRHLRFHTGEKPYKCVECYKAFPKSSSLTTHMRVHTGEKPYKCVECDKLFTKSSSLSRHMTTHTGEKSHKCVECYKAFSQLPQLICHMRIHTGEKPYKCVECNKTFSQSSNLTAHMRIHTGEKPYKCIECDKTFSQLSHLTGHMKTHSVLKPYKSAECDKSVSNFSNSSTHMRTLTGEKFVECKKI

Sequence clustering based on sequence similarity using MMseqs2