Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 6.1 4.1e+03 -0.7 0.0 22 48 7 33 5 37 0.81

2 9 0.027 18 6.8 0.0 21 46 34 59 26 67 0.86

3 9 4.2 2.8e+03 -0.2 0.0 20 45 89 114 72 117 0.83

4 9 0.0012 0.8 11.2 0.1 21 52 118 149 110 151 0.89

5 9 0.088 60 5.2 0.0 21 52 199 230 192 231 0.86

6 9 0.098 66 5.0 0.0 21 45 227 251 225 259 0.86

7 9 1.6 1.1e+03 1.2 0.0 21 48 255 282 251 286 0.84

8 9 0.21 1.4e+02 4.0 0.0 21 52 283 314 276 315 0.87

9 9 0.3 2e+02 3.5 0.0 21 43 311 333 308 337 0.91

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	6.1	4.1e+03	-0.7	0.0	22	48	7	33	5	37	0.81
2	9	0.027	18	6.8	0.0	21	46	34	59	26	67	0.86
3	9	4.2	2.8e+03	-0.2	0.0	20	45	89	114	72	117	0.83
4	9	0.0012	0.8	11.2	0.1	21	52	118	149	110	151	0.89
5	9	0.088	60	5.2	0.0	21	52	199	230	192	231	0.86
6	9	0.098	66	5.0	0.0	21	45	227	251	225	259	0.86
7	9	1.6	1.1e+03	1.2	0.0	21	48	255	282	251	286	0.84
8	9	0.21	1.4e+02	4.0	0.0	21	52	283	314	276	315	0.87
9	9	0.3	2e+02	3.5	0.0	21	43	311	333	308	337	0.91

Coding Sequence: atgaggattcatatgGCTGACAAACCATTCAATTGTGTAGAGTGTGGTAATTCCTTTTCAAAGTCCTcacatttaaaagaacacatgaggattcacactggcgagaaaccatttaaatgtgcagagtgtgataaattattttcacactcCTCAAATTTAAGAACCCACATGAGAGCTcatactggtgagaaaccatacaaatgtgttgagtgtgataaaactttCTCACATCTCTCAAGCTTAAATAAACACATGACTGTTCACAgtggtgagaaaccatataaatgtgttgagtgtgataaaactttCTCACAACTCTCAAGCTTAAAtaaacacatgaggattcacagtGGTGAGAAACCCTTCAAGTGTGTTGAGTGCTATATAACTTTCTCCCAATCCGCAAGTTTAACAaaacatatgaggattcatactgttgagaagccatacaaatgtgttgagtgtgatgaAACTTTCTCACAACTCTCAAGCTTAAATgaacacatgaggattcacagtAGTGAGAAACCATTCAAGTGTGAAAAAACATTCTCACTTCTCTCAAGTTTAAATCAACACATGCGGATTCACAGTGGTGAGAAACCTTTCaagtgtgttgagtgttttCTAACTTTCTCACAATCCGGAAGTTTAACAAGCCATATGaagattcacactggtgaaaagccatacaaatgtattGAGTGTCTTAAATCATTCTCACAATCCTCTAACTTAACAAAACACtggaggactcacactggtgagaaaccatacaaatgtgttgaatgtgaacAAACTTTCTCAGATTCTTCAAGCTTGAAtaaacacatgaggattcacactggtgaaaaaccatacaattgTGTTGAATGTGATCAAACTTTCTCAGAATCTTCAACGCTGAAGAAACActtgaggattcacactggtgaaaagccttacaaatgtgttgagtgtgataaagtATTCTCAAGCTCCTCAAACTTAAAAATGCACAAgagaactcacactggtgagaattCAAATAGTTGCTTTTGA
Protein Sequence: MRIHMADKPFNCVECGNSFSKSSHLKEHMRIHTGEKPFKCAECDKLFSHSSNLRTHMRAHTGEKPYKCVECDKTFSHLSSLNKHMTVHSGEKPYKCVECDKTFSQLSSLNKHMRIHSGEKPFKCVECYITFSQSASLTKHMRIHTVEKPYKCVECDETFSQLSSLNEHMRIHSSEKPFKCEKTFSLLSSLNQHMRIHSGEKPFKCVECFLTFSQSGSLTSHMKIHTGEKPYKCIECLKSFSQSSNLTKHWRTHTGEKPYKCVECEQTFSDSSSLNKHMRIHTGEKPYNCVECDQTFSESSTLKKHLRIHTGEKPYKCVECDKVFSSSSNLKMHKRTHTGENSNSCF

Sequence clustering based on sequence similarity using MMseqs2