Eocu044054.1
Basic Information
- Insect
- Eucriotettix oculatus
- Gene Symbol
- ZNF22_4
- Assembly
- GCA_034510155.1
- Location
- JAEMUL010000136.1:2526-3548[-]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 7 0.0034 2.3 9.7 0.1 21 46 59 84 52 89 0.88 2 7 0.0063 4.3 8.8 0.1 22 52 116 146 109 147 0.84 3 7 4 2.7e+03 -0.1 0.0 21 51 171 201 166 204 0.83 4 7 4.7 3.2e+03 -0.4 0.0 21 46 227 252 219 258 0.85 5 7 0.042 28 6.2 0.0 22 48 256 282 248 286 0.82 6 7 0.0051 3.5 9.1 0.0 21 46 283 308 280 314 0.86 7 7 0.065 44 5.6 0.0 21 46 311 336 307 338 0.90
Sequence Information
- Coding Sequence
- atgaggattcacagtggtgagaaaccatacaaatgtgttgagtgtgatgaAACTTTCTCACAACTCTCAAGCTTAAATGAACACACGAGGATTCACAGTAGAGAGAAACCATTCAAGTGTGAAAAAACATTCTCAAAACTCTCAAGCTTAAATCAACACTTGCGGATTCACAGTGGTGAGAAACCTTTCAAGTGTGTTGAGTGCTTTAAAACTTTCTCACAATCCAGAAGTTTAACAAACCATATGAACATTCACATTAGTAAAAAGCTATACAGATGTAttgagtgtgataaatcattctcaCAATCCTCTAGCTTAACAAAACACTGGAGGATCCACACTGGTcagaagccatacaaatgtgttggaTGTGGTAAATCATTCTCACAATCCAGCAACTTAAGaaaacacatgaggattcacactggtaaaaaaccatacaaatgtgttgaatgtgataaatcattctcaATAAACTCCAACTTAACAgtacacatgaggattcacactggtgaaaaaccattcaaatgtgttgagtgtgataaaactttCGCAgcattttcaaacttaaaatctcacatgaggattcacactggtgacaaaccttacaaatgtgttgaatgtgataaatcattctcaATAAACTCCAACTTAACAgtacacatgaggattcacagtggtgagaaaccatacaaatgtgttgagtgtgatgaAACTTTCTCACAACTCTCAAGCTTAAATGAACACTTGCGGATTCACAGTGGTGAGAAAACTTTCAAGTGTGTTGAGTGCTTTAAAACTTTCTCACAATCCAGAAGTTTAACAAAccatatgaggattcacactggtgaaaagccattcaaatgtattgagtgtgataaatcattctcaCAATCCTGCAACTTAAGAAAACACATGaagactcacactggtgagaagccatacaaatgtgttggaTGTGGTAAATCATTCTCACAATCCAGCAGCTTAAGAAAACACATGacgattcacactggtgagtaa
- Protein Sequence
- MRIHSGEKPYKCVECDETFSQLSSLNEHTRIHSREKPFKCEKTFSKLSSLNQHLRIHSGEKPFKCVECFKTFSQSRSLTNHMNIHISKKLYRCIECDKSFSQSSSLTKHWRIHTGQKPYKCVGCGKSFSQSSNLRKHMRIHTGKKPYKCVECDKSFSINSNLTVHMRIHTGEKPFKCVECDKTFAAFSNLKSHMRIHTGDKPYKCVECDKSFSINSNLTVHMRIHSGEKPYKCVECDETFSQLSSLNEHLRIHSGEKTFKCVECFKTFSQSRSLTNHMRIHTGEKPFKCIECDKSFSQSCNLRKHMKTHTGEKPYKCVGCGKSFSQSSSLRKHMTIHTGE
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00678713;
- 90% Identity
- iTF_00678713;
- 80% Identity
- iTF_00678713;