Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.0034 2.3 9.7 0.1 21 46 59 84 52 89 0.88

2 7 0.0063 4.3 8.8 0.1 22 52 116 146 109 147 0.84

3 7 4 2.7e+03 -0.1 0.0 21 51 171 201 166 204 0.83

4 7 4.7 3.2e+03 -0.4 0.0 21 46 227 252 219 258 0.85

5 7 0.042 28 6.2 0.0 22 48 256 282 248 286 0.82

6 7 0.0051 3.5 9.1 0.0 21 46 283 308 280 314 0.86

7 7 0.065 44 5.6 0.0 21 46 311 336 307 338 0.90

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.0034	2.3	9.7	0.1	21	46	59	84	52	89	0.88
2	7	0.0063	4.3	8.8	0.1	22	52	116	146	109	147	0.84
3	7	4	2.7e+03	-0.1	0.0	21	51	171	201	166	204	0.83
4	7	4.7	3.2e+03	-0.4	0.0	21	46	227	252	219	258	0.85
5	7	0.042	28	6.2	0.0	22	48	256	282	248	286	0.82
6	7	0.0051	3.5	9.1	0.0	21	46	283	308	280	314	0.86
7	7	0.065	44	5.6	0.0	21	46	311	336	307	338	0.90

Coding Sequence: atgaggattcacagtggtgagaaaccatacaaatgtgttgagtgtgatgaAACTTTCTCACAACTCTCAAGCTTAAATGAACACACGAGGATTCACAGTAGAGAGAAACCATTCAAGTGTGAAAAAACATTCTCAAAACTCTCAAGCTTAAATCAACACTTGCGGATTCACAGTGGTGAGAAACCTTTCAAGTGTGTTGAGTGCTTTAAAACTTTCTCACAATCCAGAAGTTTAACAAACCATATGAACATTCACATTAGTAAAAAGCTATACAGATGTAttgagtgtgataaatcattctcaCAATCCTCTAGCTTAACAAAACACTGGAGGATCCACACTGGTcagaagccatacaaatgtgttggaTGTGGTAAATCATTCTCACAATCCAGCAACTTAAGaaaacacatgaggattcacactggtaaaaaaccatacaaatgtgttgaatgtgataaatcattctcaATAAACTCCAACTTAACAgtacacatgaggattcacactggtgaaaaaccattcaaatgtgttgagtgtgataaaactttCGCAgcattttcaaacttaaaatctcacatgaggattcacactggtgacaaaccttacaaatgtgttgaatgtgataaatcattctcaATAAACTCCAACTTAACAgtacacatgaggattcacagtggtgagaaaccatacaaatgtgttgagtgtgatgaAACTTTCTCACAACTCTCAAGCTTAAATGAACACTTGCGGATTCACAGTGGTGAGAAAACTTTCAAGTGTGTTGAGTGCTTTAAAACTTTCTCACAATCCAGAAGTTTAACAAAccatatgaggattcacactggtgaaaagccattcaaatgtattgagtgtgataaatcattctcaCAATCCTGCAACTTAAGAAAACACATGaagactcacactggtgagaagccatacaaatgtgttggaTGTGGTAAATCATTCTCACAATCCAGCAGCTTAAGAAAACACATGacgattcacactggtgagtaa
Protein Sequence: MRIHSGEKPYKCVECDETFSQLSSLNEHTRIHSREKPFKCEKTFSKLSSLNQHLRIHSGEKPFKCVECFKTFSQSRSLTNHMNIHISKKLYRCIECDKSFSQSSSLTKHWRIHTGQKPYKCVGCGKSFSQSSNLRKHMRIHTGKKPYKCVECDKSFSINSNLTVHMRIHTGEKPFKCVECDKTFAAFSNLKSHMRIHTGDKPYKCVECDKSFSINSNLTVHMRIHSGEKPYKCVECDETFSQLSSLNEHLRIHSGEKTFKCVECFKTFSQSRSLTNHMRIHTGEKPFKCIECDKSFSQSCNLRKHMKTHTGEKPYKCVGCGKSFSQSSSLRKHMTIHTGE

Sequence clustering based on sequence similarity using MMseqs2