Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 0.022 15 7.1 0.0 21 44 6 29 3 36 0.88

2 8 0.0047 3.2 9.2 0.0 23 52 36 65 32 67 0.90

3 8 0.0068 4.6 8.7 0.1 21 52 62 93 58 95 0.88

4 8 9.1 6.2e+03 -1.3 0.0 22 44 91 113 88 117 0.85

5 8 0.3 2e+02 3.5 0.0 21 45 118 142 110 148 0.87

6 8 0.33 2.2e+02 3.3 0.0 21 44 174 197 166 201 0.90

7 8 3.5 2.4e+03 0.0 0.0 26 45 207 226 201 234 0.78

8 8 2.2 1.5e+03 0.7 0.1 21 46 230 255 223 257 0.87

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	0.022	15	7.1	0.0	21	44	6	29	3	36	0.88
2	8	0.0047	3.2	9.2	0.0	23	52	36	65	32	67	0.90
3	8	0.0068	4.6	8.7	0.1	21	52	62	93	58	95	0.88
4	8	9.1	6.2e+03	-1.3	0.0	22	44	91	113	88	117	0.85
5	8	0.3	2e+02	3.5	0.0	21	45	118	142	110	148	0.87
6	8	0.33	2.2e+02	3.3	0.0	21	44	174	197	166	201	0.90
7	8	3.5	2.4e+03	0.0	0.0	26	45	207	226	201	234	0.78
8	8	2.2	1.5e+03	0.7	0.1	21	46	230	255	223	257	0.87

Coding Sequence: atgaggattcacaccggcgaaaagccatttaaatgtgtcgagtgttataaatcatttactCAATCGGGCCACTTAAAATCGCATATTATGACTCATATAGGCAAAAAGCCATTTACATGTGTCGAGTGTTTTAAATCGTTCACGCAATCGGGCAGTTTAAAGTCGCACATGAGGCTCCACACTGGCGAAAAGCCATTTAtatgtgtagagtgtgataaGACGTTTTCAGATTCAAGTAGTTTGAGAAGACATTTGcggattcacacaggtgaaaaaccatttaaatgttttgagtgTCTAAAATCATTTACAGATTCGAGTGCGTTGAAAGGTCATATGCGGAATCACACCGGCgaaaagccttttaaatgtgtcgagtgtttCAAATCATTTAAAGATTCAAACTGCTTAAAATACCACATGTACGTTCACATTGGTAAAAAGCtgttcaaatgtgttgagtgtgacaTGTCGTTTACAGCCTCAAGCAGTTTAAAAAATCACGtaaggattcacactggtgaaaagccgtTTCAGTGTTCCGAGTGTGATAAGACGTTCAGAGATCCGAGCACCTTAAGGAAACATGTGTGGACTCACGTGGGTGAAAAGCTGTTTGTGTGCGTTGAGTGCGATAAGACGTTCACAGATTCAAATAGTTTAAAAAGACACGTACGAAATCACGCTGGCGAGAAACCGTATAAATGTCTCGAGTGCAATAAAACATTCACAGCTGCGAGTAGTTTGAAAAAGCATATGCAACTCCACGTGGGTTACAACAAGgcataa
Protein Sequence: MRIHTGEKPFKCVECYKSFTQSGHLKSHIMTHIGKKPFTCVECFKSFTQSGSLKSHMRLHTGEKPFICVECDKTFSDSSSLRRHLRIHTGEKPFKCFECLKSFTDSSALKGHMRNHTGEKPFKCVECFKSFKDSNCLKYHMYVHIGKKLFKCVECDMSFTASSSLKNHVRIHTGEKPFQCSECDKTFRDPSTLRKHVWTHVGEKLFVCVECDKTFTDSNSLKRHVRNHAGEKPYKCLECNKTFTAASSLKKHMQLHVGYNKA

Sequence clustering based on sequence similarity using MMseqs2