Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.017 11 7.5 0.0 20 47 5 33 1 38 0.80

2 7 0.52 3.5e+02 2.7 0.0 21 47 35 61 31 67 0.85

3 7 0.0016 1.1 10.8 0.0 21 51 91 121 83 123 0.87

4 7 0.054 37 5.8 0.0 21 52 119 150 117 152 0.87

5 7 2.4 1.7e+03 0.6 0.0 22 47 148 173 145 178 0.81

6 7 0.027 18 6.8 0.0 21 47 175 201 171 206 0.86

7 7 0.019 13 7.3 0.0 21 45 203 227 198 231 0.89

#	of	c-Evalue	i-Evalue	score	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.017	11	7.5	20	47	5	33	1	38	0.80
2	7	0.52	3.5e+02	2.7	21	47	35	61	31	67	0.85
3	7	0.0016	1.1	10.8	21	51	91	121	83	123	0.87
4	7	0.054	37	5.8	21	52	119	150	117	152	0.87
5	7	2.4	1.7e+03	0.6	22	47	148	173	145	178	0.81
6	7	0.027	18	6.8	21	47	175	201	171	206	0.86
7	7	0.019	13	7.3	21	45	203	227	198	231	0.89

Coding Sequence: ATGTCGGATTCAGACTCGGATGAAAAACCATTTAAGTGCACAGTGTGTTTCAAATCATTCACAGCAGCAAGCTATTTAAAAAGACACAcgaggattcacacaggtgaaaagccgtTCAAATGCGTCGACTGCCATAAGACATTTTCGGATTCAAGTGGTTTCAAAAGGCATGTACAGAATCACTCCGGCGTGAAGCCATTCAAATGTGTCGAGTGCTTCAAATCCTTCGCGGAATCGAGCCATTTCAAAatacacatgaggattcacacaggtgaaaagccatttaaatgcgCCGagtgttataaaacattttcacagtCCTCTGAGCTAACTcaacacatgaggattcatactgggGAAAAGCCTTATAACTGCGTTGAATGTGACCAAACGTTCAAGGcttcaagtaatttaaaagaccatatgaggattcacacggGAGAGAAGCCGttcaaatgtgtcgagtgtcaCAAATCATTCAGACATTTAAGTAGTTTAAATGCTCATATAAGAATTCATACAGGtgagaagccttttaaatgtacCGAGTGTGAAAAATCATTCACGCAGTCCTCTGCGTTGAGAAAACACACGAGGATTCACACGGGTGAAAAACCGTTTAAATGTACTGAGTGCGGCAAGACATTCATTGCTTCAAGCAACTTGAAAAGACATCTGTTGATCCACACTGGTTTAAAGatctag
Protein Sequence: MSDSDSDEKPFKCTVCFKSFTAASYLKRHTRIHTGEKPFKCVDCHKTFSDSSGFKRHVQNHSGVKPFKCVECFKSFAESSHFKIHMRIHTGEKPFKCAECYKTFSQSSELTQHMRIHTGEKPYNCVECDQTFKASSNLKDHMRIHTGEKPFKCVECHKSFRHLSSLNAHIRIHTGEKPFKCTECEKSFTQSSALRKHTRIHTGEKPFKCTECGKTFIASSNLKRHLLIHTGLKI

Sequence clustering based on sequence similarity using MMseqs2