Eocu000320.1
Basic Information
- Insect
- Eucriotettix oculatus
- Gene Symbol
- -
- Assembly
- GCA_034510155.1
- Location
- CM067376.1:2914535-2915239[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 7 0.017 11 7.5 0.0 20 47 5 33 1 38 0.80 2 7 0.52 3.5e+02 2.7 0.0 21 47 35 61 31 67 0.85 3 7 0.0016 1.1 10.8 0.0 21 51 91 121 83 123 0.87 4 7 0.054 37 5.8 0.0 21 52 119 150 117 152 0.87 5 7 2.4 1.7e+03 0.6 0.0 22 47 148 173 145 178 0.81 6 7 0.027 18 6.8 0.0 21 47 175 201 171 206 0.86 7 7 0.019 13 7.3 0.0 21 45 203 227 198 231 0.89
Sequence Information
- Coding Sequence
- ATGTCGGATTCAGACTCGGATGAAAAACCATTTAAGTGCACAGTGTGTTTCAAATCATTCACAGCAGCAAGCTATTTAAAAAGACACAcgaggattcacacaggtgaaaagccgtTCAAATGCGTCGACTGCCATAAGACATTTTCGGATTCAAGTGGTTTCAAAAGGCATGTACAGAATCACTCCGGCGTGAAGCCATTCAAATGTGTCGAGTGCTTCAAATCCTTCGCGGAATCGAGCCATTTCAAAatacacatgaggattcacacaggtgaaaagccatttaaatgcgCCGagtgttataaaacattttcacagtCCTCTGAGCTAACTcaacacatgaggattcatactgggGAAAAGCCTTATAACTGCGTTGAATGTGACCAAACGTTCAAGGcttcaagtaatttaaaagaccatatgaggattcacacggGAGAGAAGCCGttcaaatgtgtcgagtgtcaCAAATCATTCAGACATTTAAGTAGTTTAAATGCTCATATAAGAATTCATACAGGtgagaagccttttaaatgtacCGAGTGTGAAAAATCATTCACGCAGTCCTCTGCGTTGAGAAAACACACGAGGATTCACACGGGTGAAAAACCGTTTAAATGTACTGAGTGCGGCAAGACATTCATTGCTTCAAGCAACTTGAAAAGACATCTGTTGATCCACACTGGTTTAAAGatctag
- Protein Sequence
- MSDSDSDEKPFKCTVCFKSFTAASYLKRHTRIHTGEKPFKCVDCHKTFSDSSGFKRHVQNHSGVKPFKCVECFKSFAESSHFKIHMRIHTGEKPFKCAECYKTFSQSSELTQHMRIHTGEKPYNCVECDQTFKASSNLKDHMRIHTGEKPFKCVECHKSFRHLSSLNAHIRIHTGEKPFKCTECEKSFTQSSALRKHTRIHTGEKPFKCTECGKTFIASSNLKRHLLIHTGLKI
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00678867;
- 90% Identity
- iTF_00678867;
- 80% Identity
- iTF_00678867;