Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.046 31 6.1 0.0 22 52 7 37 3 37 0.87

2 6 0.0088 6 8.4 0.0 21 48 34 61 32 65 0.87

3 6 0.0039 2.7 9.5 0.1 21 45 62 86 59 94 0.88

4 6 0.0021 1.4 10.4 0.0 21 49 118 146 112 149 0.87

5 6 0.065 44 5.6 0.0 22 44 147 169 142 173 0.90

6 6 0.017 12 7.4 0.0 21 51 174 204 170 206 0.87

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.046	31	6.1	0.0	22	52	7	37	3	37	0.87
2	6	0.0088	6	8.4	0.0	21	48	34	61	32	65	0.87
3	6	0.0039	2.7	9.5	0.1	21	45	62	86	59	94	0.88
4	6	0.0021	1.4	10.4	0.0	21	49	118	146	112	149	0.87
5	6	0.065	44	5.6	0.0	22	44	147	169	142	173	0.90
6	6	0.017	12	7.4	0.0	21	51	174	204	170	206	0.87

Coding Sequence: atgagaattcacactgatGATAAACctttcaaatgtgttgagtgtaatGGAACATTCTCACAATCAGGAAATTTAACAATGCACATGAGACtccacactggtgagaaaccatacacatgtgtagagtgtgataaaaACTTCTCAGATTCATCAAACTTTAAAaggcacatgagaattcacactggcgagaagccatacaaatgtgtacaATGTGATAAAGTATTCACTGATTCAACATCGTTAAGAAGGCACATGAGATCACACACTGGttataaaccatacaaatgtgtagagtgtaAAAAAGATTTCTCATTTGACTCAGTATTAAGACGTCACATGatgactcacactggtgagaaaccatacacatgtgtagagtgtgataaaaACTTCTCACAATCATCAAACTTAACAaagcacatgagaattcacactggtgataaacctttcacatgtgtagtgtgtgataaaacattttcacaatcctATCACTTAACAACCCACATGatgactcacactggtgagaaaccatacacaTGTGAAAAGTGTGGCAAAAACTTCTCACATTCATCAAACTTAACAaagcacatgagaattcacactggttaTAAACCAAAGCATTCTTTTGGTGCACAAAATCAGTTGGTCCCAAGTTTATTACACAACATTAAGTCCCGAGAAGTTGTCCAGCCTGATTACTCCTCCAGTTCCATGCACACGGACAAGCAAGTGTCTCATGTGAGAGCAGCTTCAGTGTCGGTCCAGGTCCAGCAGCAGCGCCTCTTCATCCAGCAGTTGAGACTCATGCGTCACCATAACTAG
Protein Sequence: MRIHTDDKPFKCVECNGTFSQSGNLTMHMRLHTGEKPYTCVECDKNFSDSSNFKRHMRIHTGEKPYKCVQCDKVFTDSTSLRRHMRSHTGYKPYKCVECKKDFSFDSVLRRHMMTHTGEKPYTCVECDKNFSQSSNLTKHMRIHTGDKPFTCVVCDKTFSQSYHLTTHMMTHTGEKPYTCEKCGKNFSHSSNLTKHMRIHTGYKPKHSFGAQNQLVPSLLHNIKSREVVQPDYSSSSMHTDKQVSHVRAASVSVQVQQQRLFIQQLRLMRHHN

Sequence clustering based on sequence similarity using MMseqs2