Basic Information

Transcription Factor Domain

TF Family: zf-BED
Domain: zf-BED domain
PFAM: PF02892
TF Group: Zinc-Coordinating Group
Description: The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 12 0.061 67 4.9 0.2 17 40 9 29 3 32 0.81

2 12 0.45 4.9e+02 2.1 2.4 17 38 37 59 26 60 0.75

3 12 0.0061 6.8 8.1 2.8 13 40 61 85 54 88 0.78

4 12 0.25 2.8e+02 2.9 0.6 18 41 94 114 87 116 0.73

5 12 0.013 14 7.1 4.5 14 41 118 142 110 144 0.77

6 12 0.062 68 4.9 1.1 17 36 149 169 144 172 0.73

7 12 0.0096 11 7.5 1.1 17 40 177 197 167 200 0.82

8 12 0.058 65 5.0 0.7 17 40 205 225 197 228 0.83

9 12 0.027 30 6.0 1.9 14 41 230 254 223 257 0.83

10 12 0.0036 4 8.8 0.9 17 40 261 281 255 284 0.87

11 12 0.00024 0.27 12.6 1.1 17 41 289 310 281 312 0.87

12 12 0.033 37 5.7 0.2 17 40 317 337 311 340 0.85

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	12	0.061	67	4.9	0.2	17	40	9	29	3	32	0.81
2	12	0.45	4.9e+02	2.1	2.4	17	38	37	59	26	60	0.75
3	12	0.0061	6.8	8.1	2.8	13	40	61	85	54	88	0.78
4	12	0.25	2.8e+02	2.9	0.6	18	41	94	114	87	116	0.73
5	12	0.013	14	7.1	4.5	14	41	118	142	110	144	0.77
6	12	0.062	68	4.9	1.1	17	36	149	169	144	172	0.73
7	12	0.0096	11	7.5	1.1	17	40	177	197	167	200	0.82
8	12	0.058	65	5.0	0.7	17	40	205	225	197	228	0.83
9	12	0.027	30	6.0	1.9	14	41	230	254	223	257	0.83
10	12	0.0036	4	8.8	0.9	17	40	261	281	255	284	0.87
11	12	0.00024	0.27	12.6	1.1	17	41	289	310	281	312	0.87
12	12	0.033	37	5.7	0.2	17	40	317	337	311	340	0.85

Coding Sequence: ATGAATCACACTGGTGATAAACCTTTCACatgtgtagtgtgtgataaaacattctcacaatTAGGAACTTTAACAAGGCACATGAGACTCCATGCTGGTGATAAACCATTCAAATGTATTAAGTGTGATGGAACATTCTCACAATTAGGTACCTTAACAAAgcacatgagaactcacactggtgagaaaccatacacaTGTATAGAGTGTGATAAAAACTTCTCACAATCATCAAACTTAACAATGCACATGAGATATCACACTGGTGATAAACCATTCAAATGTATTGAGTGTGATGGAACATTCTCACAATTAGCTAACTTAACAAGccacatgagaactcacactggtgagaaaccatacacatgtgtagagtgtgataaaacattttcacaatccCATAACTTAACAAGccacatgagaactcacactggtgagaaaccatataaatgtggaTTGTGTGATAGAACATTCTCACATTTAGGAAACTTAACAacgcacatgagaattcacactggtgataaaCCTTTCGCatgtgtagtgtgtgataaaacattttctaattccTCAAGCTTAAGAAcccacatgagaattcacactggtgataaacctttcacatgtgtagtgtgtgataaaacattttcacaatcctCACACTTAAGAAtccacatgagaattcacactggtgacaaaccatacaaatgtgtaaaGTGTAAAAAAGATTTCTCATTTTACTCAGCATTAAGACgtcacatgaggactcacactggtgagaaaccatacacaTGTATAGAGTGTGATAAAAACTTCTCACAATCATCAAACTTAACAatgcacatgagaattcacactggtgataaaccatacaaatgtattaAGTGTGACAGAACATTCTCACAATCATCAAACTTAACAGCgcacatgagaactcacactggtgagaaaccattcaaatgtgtagAGTGTAAAAAAGATTTCTCAGTTTCCTCAGCATTAAGACGTCACATGatgactcacactggtgagaagtaa
Protein Sequence: MNHTGDKPFTCVVCDKTFSQLGTLTRHMRLHAGDKPFKCIKCDGTFSQLGTLTKHMRTHTGEKPYTCIECDKNFSQSSNLTMHMRYHTGDKPFKCIECDGTFSQLANLTSHMRTHTGEKPYTCVECDKTFSQSHNLTSHMRTHTGEKPYKCGLCDRTFSHLGNLTTHMRIHTGDKPFACVVCDKTFSNSSSLRTHMRIHTGDKPFTCVVCDKTFSQSSHLRIHMRIHTGDKPYKCVKCKKDFSFYSALRRHMRTHTGEKPYTCIECDKNFSQSSNLTMHMRIHTGDKPYKCIKCDRTFSQSSNLTAHMRTHTGEKPFKCVECKKDFSVSSALRRHMMTHTGEK

Sequence clustering based on sequence similarity using MMseqs2