Basic Information

Insect
Euclidia mi
Gene Symbol
Sox15_1
Assembly
GCA_944738845.2
Location
CALYKX020000487.1:4376193-4376627[-]

Transcription Factor Domain

TF Family
HMG
Domain
HMG_box domain
PFAM
PF00505
TF Group
Other Alpha-Helix Group
Description
High mobility group (HMG) box domains are involved in binding DNA, and may be involved in protein-protein interactions as well. The structure of the HMG-box domain consists of three helices in an irregular array. HMG-box domains are found in one or more copies in HMG-box proteins, which form a large, diverse family involved in the regulation of DNA-dependent processes such as transcription, replication, and strand repair, all of which require the bending and unwinding of chromatin. Many of these proteins are regulators of gene expression. HMG-box proteins are found in a variety of eukaryotic organisms, and can be broadly divided into two groups, based on sequence-dependent and sequence-independent DNA recognition; the former usually contain one HMG-box motif, while the latter can contain multiple HMG-box motifs. HMG-box domains can be found in single or multiple copies in the following protein classes: HMG1 and HMG2 non-histone components of chromatin; SRY (sex determining region Y protein) involved in differential gonadogenesis; the SOX family of transcription factors [1]; sequence-specific LEF1 (lymphoid enhancer binding factor 1) and TCF-1 (T-cell factor 1) involved in regulation of organogenesis and thymocyte differentiation [2]; structure-specific recognition protein SSRP involved in transcription and replication; MTF1 mitochondrial transcription factor; nucleolar transcription factors UBF 1/2 (upstream binding factor) involved in transcription by RNA polymerase I; Abf2 yeast ARS-binding factor [3]; yeast transcription factors lxr1, Rox1, Nhp6b and Spp41; mating type proteins (MAT) involved in the sexual reproduction of fungi [4]; and the YABBY plant-specific transcription factors.
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 1 2.5e-14 6.3e-11 44.7 0.0 2 37 97 132 96 135 0.95

Sequence Information

Coding Sequence
ATGATGGATTCCGGAGGGGCAGGCATAGCAGAATCACCACCTACATACCACCGGAGCTACGAGCAGTACGTCCAAGGAGCAGTTGAGAACAGCACCGACTCAGTCCAGGAGCAGACCAGTCCAGAGCTGGTCGTTTGGTCCACGCTACCTTACGGCTTAGACTACAGAGCGCAGTACGAATACAGGAGCCCATATGACACTAGCAGGGATTATTCCACGCAGCAGTATGCTAGAGCTCCCTTCACGACTAAGATGGGACAGGCCAAAGCCCTAAAAGAGGCAAGAATAAGGCGGCCTATGAATGCTTTTATGGTGTGGGCGAAGGTCGAAAGGAAGAAACTGGCTGACGAGAATCCGGACCTGCATAACGCCGATCTGAGTAAAATGCTAGGTAAGTGTTTTGAATTTGGAACTGTATTTGTTGTTTTTGTTTGA
Protein Sequence
MMDSGGAGIAESPPTYHRSYEQYVQGAVENSTDSVQEQTSPELVVWSTLPYGLDYRAQYEYRSPYDTSRDYSTQQYARAPFTTKMGQAKALKEARIRRPMNAFMVWAKVERKKLADENPDLHNADLSKMLGKCFEFGTVFVVFV

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity
iTF_00458049; iTF_00457231; iTF_00695599; iTF_00923681; iTF_00204353; iTF_00922876; iTF_01402716; iTF_00960930; iTF_00683364; iTF_00467411; iTF_00723958; iTF_00682431; iTF_01178564; iTF_00288867; iTF_00942821; iTF_00786791; iTF_01020295; iTF_00824745; iTF_01080716; iTF_01079893; iTF_00207917; iTF_00212464; iTF_00621232; iTF_00775249; iTF_00776721; iTF_00689397; iTF_01148085; iTF_00150550; iTF_00355158; iTF_00356200; iTF_00723063; iTF_00076536; iTF_00650009; iTF_00649097; iTF_00025244; iTF_00159839; iTF_00673504; iTF_01181888; iTF_00013026; iTF_00195167; iTF_00120514; iTF_00186179; iTF_00928707; iTF_01027331; iTF_00685444; iTF_01439940; iTF_00667493; iTF_00121446; iTF_00147462; iTF_00745703; iTF_01221575; iTF_01441095; iTF_01094920; iTF_01526024; iTF_00039818; iTF_01028298; iTF_00907051; iTF_01031147; iTF_01425067; iTF_00042636; iTF_00374124; iTF_01246988; iTF_01338764; iTF_00071437; iTF_00237581; iTF_00906157; iTF_00043502; iTF_00888270; iTF_00924686; iTF_01093102; iTF_00124272; iTF_00794609; iTF_00041778; iTF_00049906; iTF_01533938; iTF_01532019; iTF_00123380; iTF_00040821; iTF_00449109; iTF_01063765; iTF_00036727; iTF_01029271; iTF_00038777; iTF_00037819; iTF_00711867; iTF_01094043; iTF_00726364; iTF_01030236; iTF_01064668; iTF_00758173; iTF_00831229; iTF_00364031; iTF_00122400; iTF_00185312; iTF_01527232; iTF_00205123; iTF_00354083; iTF_01018565; iTF_00843536; iTF_00353074; iTF_00634485; iTF_00926606; iTF_00275267; iTF_00255908; iTF_00256912; iTF_00876170; iTF_00875306; iTF_00874462; iTF_00213445; iTF_00166919; iTF_01564653; iTF_01332710; iTF_00198119; iTF_00448135; iTF_00009025; iTF_00364929; iTF_00651745; iTF_01152161; iTF_01437985; iTF_00889218; iTF_01415843; iTF_01502979; iTF_00823044; iTF_01083332; iTF_01141668; iTF_01156452; iTF_01333828; iTF_01280294; iTF_00325383; iTF_00787655; iTF_00840295; iTF_00970407; iTF_00341320; iTF_00855880; iTF_00006281; iTF_01148809; iTF_01360618; iTF_00034731; iTF_00279115; iTF_00971371; iTF_01130027; iTF_00932556; iTF_01502092; iTF_00833006; iTF_01387598; iTF_00468175; iTF_00007088; iTF_00074512; iTF_00859472; iTF_01073617; iTF_01176177; iTF_01386705; iTF_01416785; iTF_00858546; iTF_00931410; iTF_01145266; iTF_01282290; iTF_01115699; iTF_01496595; iTF_00208884; iTF_00681652; iTF_01146228; iTF_01463252; iTF_01334901; iTF_01544885; iTF_01143830; iTF_01337751; iTF_00709240; iTF_00795705; iTF_01125465; iTF_01385755; iTF_00187164; iTF_01157788; iTF_01251740; iTF_01153022; iTF_00284543; iTF_01341279; iTF_00021324; iTF_00720295; iTF_00112499; iTF_01316355; iTF_00113321; iTF_01503883; iTF_01317295; iTF_01220657; iTF_00072818; iTF_00148469; iTF_00149397; iTF_00146427; iTF_01285543; iTF_00784397; iTF_01082440; iTF_01359752; iTF_00177129; iTF_00809143; iTF_00810073; iTF_00274431; iTF_00806729; iTF_00178160; iTF_01166698; iTF_00908849; iTF_00636407; iTF_00637657; iTF_00404926; iTF_00008011; iTF_00959403; iTF_00960164; iTF_00958664; iTF_00425388; iTF_00752076; iTF_00447149; iTF_00446148; iTF_00445184; iTF_01336845; iTF_01264621; iTF_00642318; iTF_00907886; iTF_01071630; iTF_01547553; iTF_01084270; iTF_01401294; iTF_01021231; iTF_01158959; iTF_00277360; iTF_00408464; iTF_00782640; iTF_00781021; iTF_01081591; iTF_01490128; iTF_00761681; iTF_00622000; iTF_01429938; iTF_00429012; iTF_00428125; iTF_01230590; iTF_00819167; iTF_00236628; iTF_01192721; iTF_01438929; iTF_00622834; iTF_00345811; iTF_01222477; iTF_00776019; iTF_01140916; iTF_01142388; iTF_00011989; iTF_00640325; iTF_00290709; iTF_00063593; iTF_01358872; iTF_00654288; iTF_00871291; iTF_00844350; iTF_01501118; iTF_00674293; iTF_00994351; iTF_00706965; iTF_00441495; iTF_01180310; iTF_01179492; iTF_01562006; iTF_01090775; iTF_00075544; iTF_01279256; iTF_00323513; iTF_01041754; iTF_01569337; iTF_01436090; iTF_01075442; iTF_00382619; iTF_00035662; iTF_00783485; iTF_01173277; iTF_01533053; iTF_00778750; iTF_01495776; iTF_01494308; iTF_01495046;
90% Identity
iTF_01437985;
80% Identity
-