Basic Information

Transcription Factor Domain

TF Family: zf-BED
Domain: zf-BED domain
PFAM: PF02892
TF Group: Zinc-Coordinating Group
Description: The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 4.1 1e+04 -1.1 3.6 17 42 16 37 10 39 0.75

2 8 0.31 7.6e+02 2.5 3.4 4 26 32 53 29 64 0.77

3 8 0.0024 5.9 9.2 0.2 18 44 73 96 68 96 0.92

4 8 0.0052 13 8.1 1.3 9 29 100 120 98 126 0.83

5 8 5.2e-06 0.013 17.7 0.5 5 40 125 159 121 162 0.86

6 8 0.0027 6.6 9.1 2.6 13 28 163 178 156 190 0.75

7 8 0.0043 11 8.4 1.2 14 40 192 215 180 218 0.77

8 8 0.41 1e+03 2.1 0.1 18 38 224 241 217 245 0.85

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	4.1	1e+04	-1.1	3.6	17	42	16	37	10	39	0.75
2	8	0.31	7.6e+02	2.5	3.4	4	26	32	53	29	64	0.77
3	8	0.0024	5.9	9.2	0.2	18	44	73	96	68	96	0.92
4	8	0.0052	13	8.1	1.3	9	29	100	120	98	126	0.83
5	8	5.2e-06	0.013	17.7	0.5	5	40	125	159	121	162	0.86
6	8	0.0027	6.6	9.1	2.6	13	28	163	178	156	190	0.75
7	8	0.0043	11	8.4	1.2	14	40	192	215	180	218	0.77
8	8	0.41	1e+03	2.1	0.1	18	38	224	241	217	245	0.85

Coding Sequence: ATGAACATTGCTCGCCACAAATTGCTCCACACAGGTGTAAAAAGATACACTTGTAACCTTTGTGATTATGCTTGTTATCAGAAAACAAATCTTAAATATCATCAGCGAAGACACTCCAAgaactatttttatatctgcGAAATCTGTGATAAAGGATTTCATCAAAGAAAAGAGCTGATTGAACACGAAAATGTACATTCTGGTCTCAAACCTTACCAATGTCAATTCTGTGACAAGTCTTATccatataagaaaaatttggtcTCTCATATCAGCATTCACCATCCTGAAACGACTAGAGCAAAGCTGACCAACTATAAATACAAGTGTCAATTTTGCAATGAAAGATTTTCTAataagaaagtatttctgaggCATGCAAAACTACATCAGACCTTGTTGAAAAGTTCCAAGGTTTTATGTGATTTGTGTGGTAAGGTGTTATCCTCAAAAAGTGCTCTTACTCAACACTTGAAATTACACTCTGGAGAGAAATTCATCAACTGTAACATTTGTGGCAAAAGTTTCACCAAATGGGAAAATTTGAAGGTTCATCAGCGAACACACACAGGAGAGAAACCATTTATTTGCTCGATGTGTGGTAAAACCTTTTCGCAAAAATCGACACTTGTTATTCACCTGAGATACCACACTGGAGAAAGACCTTATCGATGTTCAGATTGTGGGAAGGATTTCGTTTCCAGTTCGCTCCTGAAGAGACATCGACAAATTCATAATAATCCTAAGccttag
Protein Sequence: MNIARHKLLHTGVKRYTCNLCDYACYQKTNLKYHQRRHSKNYFYICEICDKGFHQRKELIEHENVHSGLKPYQCQFCDKSYPYKKNLVSHISIHHPETTRAKLTNYKYKCQFCNERFSNKKVFLRHAKLHQTLLKSSKVLCDLCGKVLSSKSALTQHLKLHSGEKFINCNICGKSFTKWENLKVHQRTHTGEKPFICSMCGKTFSQKSTLVIHLRYHTGERPYRCSDCGKDFVSSSLLKRHRQIHNNPKP

Sequence clustering based on sequence similarity using MMseqs2