Basic Information

Transcription Factor Domain

TF Family: zf-BED
Domain: zf-BED domain
PFAM: PF02892
TF Group: Zinc-Coordinating Group
Description: The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.04 1.2e+02 5.2 0.4 6 28 34 55 29 68 0.77

2 7 0.00056 1.7 11.1 0.6 18 44 73 96 69 96 0.94

3 7 0.18 5.6e+02 3.1 1.6 12 28 103 119 98 128 0.79

4 7 0.00011 0.33 13.4 0.6 13 40 135 159 125 162 0.84

5 7 0.0023 7.1 9.1 2.6 13 28 163 178 156 187 0.77

6 7 0.0011 3.4 10.2 0.4 7 40 186 215 180 221 0.75

7 7 0.73 2.2e+03 1.2 0.0 18 38 224 241 218 245 0.82

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.04	1.2e+02	5.2	0.4	6	28	34	55	29	68	0.77
2	7	0.00056	1.7	11.1	0.6	18	44	73	96	69	96	0.94
3	7	0.18	5.6e+02	3.1	1.6	12	28	103	119	98	128	0.79
4	7	0.00011	0.33	13.4	0.6	13	40	135	159	125	162	0.84
5	7	0.0023	7.1	9.1	2.6	13	28	163	178	156	187	0.77
6	7	0.0011	3.4	10.2	0.4	7	40	186	215	180	221	0.75
7	7	0.73	2.2e+03	1.2	0.0	18	38	224	241	218	245	0.82

Coding Sequence: ATGAATATTGCTCGACACAAATTACTCCACGTCGGGGTAAAACGCTACACTTGCGATATATGCGATTACTCCTGTTACCAGAAAACAAATCTCGAATATCATCAACGAAGACACTCAAAAGACTATTTCTACATTTGTGAAATATGCTCAAAAGGATTTCAACAGAGGAAAGAACTAATCGAACACGAGAATACACATTCCGGTATCAAACCCTATCAGTGTCAACTATGTGAGAAGTCTTATCCATACAAGAAAAATCTCGTCTCCCACATCAAGATTCATCATCCTGAACTTACCAGGACTAGGACGAGGAGCTATAAACATAAATGTCAATTTTGCAAGGagagattttacaataaaaaactgcTTCAGCAACATTCCAAGATGCATCAGAGTTTGCCGAAAAGTTCGAAAGTTTTGTGCGATTTGTGCGGTCAGCAGTTGTCCTCAAAAAGTGCGCTTACTCATCATCTGAAACTACATTCTGGAGAAAAATCGATCAGCTGTAATATTTGTGGAAAAGCTTTTTCTAAGTGGGATAATCTGAAGGTTCATCAGAGAATTCACACGGGAGAGAAGCCATTTACTTGCTCGCTGTGTGGGAAagctttttctcaaaaatccacACTGGTTCTGCACCTTAGGTACCATACTGGGGAAAGACCTTACCGATGTCCAGATTGCGGAAAGGATTTTGTCTCCAGTTCGCTTTTGAAAAGACATAGACTAACTCATGTTAATACTAAGctctaa
Protein Sequence: MNIARHKLLHVGVKRYTCDICDYSCYQKTNLEYHQRRHSKDYFYICEICSKGFQQRKELIEHENTHSGIKPYQCQLCEKSYPYKKNLVSHIKIHHPELTRTRTRSYKHKCQFCKERFYNKKLLQQHSKMHQSLPKSSKVLCDLCGQQLSSKSALTHHLKLHSGEKSISCNICGKAFSKWDNLKVHQRIHTGEKPFTCSLCGKAFSQKSTLVLHLRYHTGERPYRCPDCGKDFVSSSLLKRHRLTHVNTKL

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00011379; iTF_01389674; iTF_01390537; iTF_00676960; iTF_00676985;
90% Identity: iTF_00011379;
80% Identity: iTF_00011379;