Basic Information

Transcription Factor Domain

TF Family: BTB
Domain: zf-C2H2|ZBTB
PFAM: PF00651
TF Group: Zinc-Coordinating Group
Description: The BTB (for BR-C, ttk and bab) [6] or POZ (for Pox virus and Zinc finger) [1] domain is present near the N-terminus of a fraction of zinc finger (Pfam:PF00096) proteins and in proteins that contain the Pfam:PF01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation [1]. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule [2]. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT [5, 3, 4]. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 2 1.9e-16 4.9e-14 54.2 0.2 2 106 178 279 177 283 0.89

2 2 4.2 1.1e+03 1.6 0.0 80 107 285 312 276 314 0.87

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	2	1.9e-16	4.9e-14	54.2	0.2	2	106	178	279	177	283	0.89
2	2	4.2	1.1e+03	1.6	0.0	80	107	285	312	276	314	0.87

Coding Sequence: ATGAGTGTATCGCACGCAGGAATACTGATCAAAAAGTCACCAAGTTACAAGTGGATCCTAAATAATTCTTGCATCAAATCGTGTAAAAATATTGGAGATGCTGTCGAGTCACCACCAATTGAAATTGACACGAATAATGGGTCCAAGCAATCGTGGGCCCTCCGATTTTATCCAAAAAGTAAGGACGGTATCGAAACAAAGTTCGCATCAATCGTTTTGGTTTCGAAAAATGTGTCCAAAACTGAAGTCTTTTTTGATTTCGCCGTAATCCAAGAGAAGAATGTGATTCATCTGTACGACGACGGTCAGTTGGTGTCTTTTCCGCGTAAGAATTTTGAGTGGGGCGACAGATTGTTGAGAAAGAGTCAAATAATGGATGGTGTTAGTGGCAAGTTGAAATGCAACAGATTAACCATTTTGTGTCGAATCAGACCACCTTTTTACGCCGAGATTGACAACCTGATGGCAGATATGAATAAACAAATCATTCACAAGTCTGATGAAGATGAGACAGAAGACAACGACGCGTTCAATAATCTCATAGTTGAtgatagttttggagatttttcatTGATAGTTCGAGGCAAAGTTTTTCGAGTACATGCAGATATTTTAAGCGAGCAGAGTTATCAATTTGCTGAAATTGTTTCAAATCAAAGAGGAAAGAACAGAAAAGTTGCATTTATCGATGACATGGATCCTCGTGTATTTTCTCAGATTCTGAGAGTGATATACTTTCAAGATGTCATCGTGGATGTAGATAAAATAGCTGATCTTCTCATAGCTGCTGATAAATACTCACTGGAAAAATTGTATGCTGCATGTGAAATGTGTATGCTTGCAACATTTGGCAATAGTAATATGGTCAAGTATCTCAAATTTGCACACAAACACGGTATGGTTGAACTCAAGAAAACACTTGTTGAATTCATAACGGTGAATTTTCCCGAAATGCTTGCCGATGATTGCTTCGAGTCGATTAAGAATTTGGAACCGGATCTCATGTTTGAAGTTATGCAAGGGATGGCAAAGTTATGA
Protein Sequence: MSVSHAGILIKKSPSYKWILNNSCIKSCKNIGDAVESPPIEIDTNNGSKQSWALRFYPKSKDGIETKFASIVLVSKNVSKTEVFFDFAVIQEKNVIHLYDDGQLVSFPRKNFEWGDRLLRKSQIMDGVSGKLKCNRLTILCRIRPPFYAEIDNLMADMNKQIIHKSDEDETEDNDAFNNLIVDDSFGDFSLIVRGKVFRVHADILSEQSYQFAEIVSNQRGKNRKVAFIDDMDPRVFSQILRVIYFQDVIVDVDKIADLLIAADKYSLEKLYAACEMCMLATFGNSNMVKYLKFAHKHGMVELKKTLVEFITVNFPEMLADDCFESIKNLEPDLMFEVMQGMAKL

Sequence clustering based on sequence similarity using MMseqs2