Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 2 0.91 3.1e+03 -0.3 0.7 12 15 247 250 244 254 0.86

2 2 1.1e-08 3.7e-05 25.0 4.3 8 21 289 302 284 302 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	2	0.91	3.1e+03	-0.3	0.7	12	15	247	250	244	254	0.86
2	2	1.1e-08	3.7e-05	25.0	4.3	8	21	289	302	284	302	0.89

Coding Sequence: ATGACAGTACCACCTCACGCCGCCCATTGCAATCTAGCAGAACGATACATAAGAACAATCAAGACGTCCATTATCGCATATTTAGAGGacaaacatagtcgctgggacgaaCATGTGAAGGAACTTCAGTTCGCGTATAAATCAAGCGTCCAACATTCAGCTCACCTCAGtccagcttttatgaactatggacGTAATCCAGTTCCTCCCAAAAATTTCAAGCGTCAGCAAGAACTCGCGTCTGCTGAAAAAGAGCTAGTGCAAGCAGTAAGCAAGTGGCAAGGACATACGCTCAAATTGCCTGACTTACATATGGTCGCACCGATCAATTCACAGAGTGCTCACGAGCATCGAGCTCGATCTTACAACAAAAAGGGACGTGATGTCCAATATCCAGCAAGAGATGCTGTCTGGAAGCGTAACAGAGTCTTATCATCACAGGCTCAGAGTATCACAGGCAAACTCGCACCTCGATTCGATGGCAAATTAACCATCTCAGCCCGACTCGGCTCAAATGTTTACGAACTAGCCGATGAATCGGGCCAAAGAATCGGAAAAGTGCATGTTCAAGACCTGAAACCCTACATCGATGGTGAAGAGCTCCTAAACGAACCAGAAATTGAACGGTCAATGATCGGTCCATCTGACGATAATTCGTTTAACCGAGGATCATGGCGTGTGCTGAGACCCGCAAAAAACGTTGCATCAAAGCCGAGCACTCCGAAAATTACAAATAAGAGAGGCCGGCCAAGAAAAACCAAAATCGTGGTAACTAAAGAATGCGTCAGTTTCGTGCCCTCAATTCAGCATGAACCAGACCATAATACGGTCGACAGAGCTCGGGCGCAGACGACCGAAACCATACCGAAACGACCGCGTGGCCGACCAAAAGGATCGACTAAGAAGTag
Protein Sequence: MTVPPHAAHCNLAERYIRTIKTSIIAYLEDKHSRWDEHVKELQFAYKSSVQHSAHLSPAFMNYGRNPVPPKNFKRQQELASAEKELVQAVSKWQGHTLKLPDLHMVAPINSQSAHEHRARSYNKKGRDVQYPARDAVWKRNRVLSSQAQSITGKLAPRFDGKLTISARLGSNVYELADESGQRIGKVHVQDLKPYIDGEELLNEPEIERSMIGPSDDNSFNRGSWRVLRPAKNVASKPSTPKITNKRGRPRKTKIVVTKECVSFVPSIQHEPDHNTVDRARAQTTETIPKRPRGRPKGSTKK

Sequence clustering based on sequence similarity using MMseqs2