Dtit011943.1
Basic Information
- Insect
- Dynastes tityus
- Gene Symbol
- PAX6_2
- Assembly
- GCA_029618875.2
- Location
- JAROYD020000002.1:76147380-76149103[-]
Transcription Factor Domain
- TF Family
- PAX
- Domain
- PAX domain
- PFAM
- PF00292
- TF Group
- Helix-turn-helix
- Description
- The paired domain, a ~126 amino acid DNA-binding domain, is found in eukaryotic transcription regulatory proteins involved in embryogenesis. Initially identified in Drosophila’s paired (prd) protein, it typically resides in the N-terminal region and may be followed by an octapeptide, a homeodomain, or a Pro-Ser-Thr-rich C terminus. Paired domain proteins act as transcription repressors or activators, with DNA-binding specificity mediated by three subdomains. Crystal structures reveal a bipartite DNA-binding paired domain: an N-terminal subdomain (PAI) and a C-terminal subdomain (RED), linked by a flexible linker. Both subdomains contain a helix-turn-helix motif that binds DNA's major groove, while the linker may bind the minor groove. Variations in domain usage across Pax proteins and isoforms determine sequence specificity.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 8.6e-70 1.7e-66 223.5 0.3 2 118 19 135 18 138 0.99
Sequence Information
- Coding Sequence
- ATGCTGGAAGAGTTTTCAGGAAAGAAGGCCAAAGGAAAGAAGTCAAGGAAGTGTCATAGCGGTGTGAATCAGCTAGGGGGGGTTTTCGTCAGCGGCCGTCCCTTGCCAGACTCCACCAGGCAGAAGATTGTCGAACTCGCGCATTCCGGAGCCCGGCCGTGCGATATCTCCCGGATCCTACAAGTCTCCAACGGTTGCGTCTCTAAAATATTGGGGAGGTATTACGAAACTGGATCAATTAGACCTCGAGCAATAGGAGGATCCAAACCAAGAGTCGCCACGGCTGAAGTAGTGTCCAAAATCTCCGCTTACAAGCGGGAATGTCCTTCGATTTTCGCGTGGGAAATTCGTGATAGATTGCTGCAGGAAGGAGTCTGTACGAATGATAACATTCCCAGCGTAAGTAAACCACTTTTTCATCCAAACTATATACTTATCCTGTag
- Protein Sequence
- MLEEFSGKKAKGKKSRKCHSGVNQLGGVFVSGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATAEVVSKISAYKRECPSIFAWEIRDRLLQEGVCTNDNIPSVSKPLFHPNYILIL
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00031895; iTF_00087107; iTF_00217697; iTF_01011171; iTF_01398435; iTF_00987079; iTF_00085320; iTF_00753704; iTF_01262408; iTF_01383560; iTF_00286281; iTF_00369514; iTF_01512138; iTF_00414252; iTF_01391053; iTF_00440271; iTF_01364592; iTF_00460465; iTF_00713617; iTF_01194353; iTF_00219059; iTF_00229299; iTF_00224500; iTF_01022164; iTF_00084501; iTF_01287157; iTF_00687127; iTF_00151385; iTF_00996986; iTF_00306204; iTF_00863901; iTF_01268991;
- 90% Identity
- -
- 80% Identity
- iTF_00369514;