Dani003407.1
Basic Information
- Insect
- Dryomyza anilis
- Gene Symbol
- PAXBP1
- Assembly
- GCA_951804985.1
- Location
- OX638130.1:49068977-49069517[+]
Transcription Factor Domain
- TF Family
- GCFC
- Domain
- GCFC domain
- PFAM
- PF07842
- TF Group
- Unclassified Structure
- Description
- This entry describes a domain found in a number of GC-rich sequence DNA-binding factor proteins and homologues [4, 5], as well as in a number of other proteins including Tuftelin-interacting protein 11 [1]. While the function of the domain is unknown, some of the proteins it is found in are reported to be involved in pre-mRNA splicing [1, 2]. This domain is also found in Sip1, a septin interacting protein [3].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 2.8e-08 5.4e-05 24.0 0.0 17 59 2 45 1 51 0.90 2 2 2.8e-08 5.4e-05 23.9 0.0 126 169 55 99 43 114 0.86
Sequence Information
- Coding Sequence
- ATGGAATCGTATAAGGATGCTTTTGTCAGTCTTTGTCTGCccaagttttGTCTTGGACCCTTAATACGCGTGGAGCTACTCAATTGGTCGCCGCTCAATGACGAATACAAAGATATTGAGAAAATGAATAGGTTTGCGGCATCCATGCTGTACGCTTATGTGCCCACGATTATTGAGAAAATTATACTGCCGAAAATAACAGAAATTGTTAAATTCTGCTGGGATCCACTGTCTACATCGCAAACACTACGTTTGATCGGCTGCATAAATCGACTCGGACGTGATTTTCCTCTAAAAGAAACACTcaaaagaaaatgtaccattaagtactttatgatACGACcgttgatcttatggttcatgtattaa
- Protein Sequence
- MESYKDAFVSLCLPKFCLGPLIRVELLNWSPLNDEYKDIEKMNRFAASMLYAYVPTIIEKIILPKITEIVKFCWDPLSTSQTLRLIGCINRLGRDFPLKETLKRKCTIKYFMIRPLILWFMY
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -