Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.0068 3e+02 5.1 0.7 20 31 5 16 2 26 0.83

2 7 0.011 4.7e+02 4.5 0.0 21 44 33 56 24 60 0.87

3 7 0.00085 38 8.0 0.2 21 44 61 84 57 91 0.82

4 7 0.034 1.5e+03 2.9 0.0 26 44 94 112 85 116 0.85

5 7 0.0026 1.2e+02 6.4 0.2 21 44 117 140 115 144 0.91

6 7 3.8e-05 1.7 12.3 0.9 22 44 146 168 141 173 0.85

7 7 0.00012 5.4 10.7 0.0 21 44 173 196 170 200 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.0068	3e+02	5.1	0.7	20	31	5	16	2	26	0.83
2	7	0.011	4.7e+02	4.5	0.0	21	44	33	56	24	60	0.87
3	7	0.00085	38	8.0	0.2	21	44	61	84	57	91	0.82
4	7	0.034	1.5e+03	2.9	0.0	26	44	94	112	85	116	0.85
5	7	0.0026	1.2e+02	6.4	0.2	21	44	117	140	115	144	0.91
6	7	3.8e-05	1.7	12.3	0.9	22	44	146	168	141	173	0.85
7	7	0.00012	5.4	10.7	0.0	21	44	173	196	170	200	0.89

Coding Sequence: ATGCTGAAGCATACGTCGGAAAAACCCTTTGTGTGCCCGGTGTGCCCTGGTCAGTGCACGTGTAGTGATAACCAGTCATATATTCATAGCACTTCTGTCGAGAAACCTTTCCTGTGTTCTATGTGCCCAGCCATGTTTAAGAAAAAGGTTCAGTTGAGCTACCACTTGTTGAGTCACTCTGGTGAAAGACCTTTCGTGTGCCCCATCTGTCCGGCCAAGTTTGCACGAAAAGCGTATCTGACCTCGCACCTTAGCAATCATGCTGGGCAGAAACGATTCTCTTGTACTGTTTGCTCGAGCAAGTTTAATGTGAAGGGTAACTTGAAAAGGCACATGCTTATACACACGGGTGAGAGACCTTTCTCATGTACCATTTGCCCGGCCAAATTCAACCAGAAGAGCTGCCTGAACATGCACCTCATCAGTCACTCTGGCGAGAAGAGGTTTCCATGTCCCTTTTGCCCAGCCCAGTATGCACAGAAGAGAAACCAGAGAAGACACATTCTCACTCACACGGGGGAGAAACCGTTCTCTTGTCCCCTCTGCCCCGCTGTGTTCACAGTAAAGCAGAAATTGAACAAGCACATCCTCATTCACACCGATGAGAAAACATGA
Protein Sequence: MLKHTSEKPFVCPVCPGQCTCSDNQSYIHSTSVEKPFLCSMCPAMFKKKVQLSYHLLSHSGERPFVCPICPAKFARKAYLTSHLSNHAGQKRFSCTVCSSKFNVKGNLKRHMLIHTGERPFSCTICPAKFNQKSCLNMHLISHSGEKRFPCPFCPAQYAQKRNQRRHILTHTGEKPFSCPLCPAVFTVKQKLNKHILIHTDEKT

Sequence clustering based on sequence similarity using MMseqs2