Basic Information

Transcription Factor Domain

TF Family: IRF
Domain: IRF domain
PFAM: PF00605
TF Group: Helix-turn-helix
Description: This family of transcription factors are important in the regulation of interferons in response to infection by virus and in the regulation of interferon-inducible genes. Three of the five conserved tryptophan residues bind to DNA.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 11 0.31 3.5e+04 -1.3 0.0 8 23 10 25 9 33 0.81

2 11 0.045 5.1e+03 1.3 0.0 11 32 24 44 18 51 0.67

3 11 0.05 5.6e+03 1.2 0.0 8 25 65 82 64 84 0.84

4 11 0.21 2.3e+04 -0.8 0.0 8 25 87 104 86 106 0.83

5 11 0.31 3.5e+04 -1.3 0.0 8 23 109 124 108 132 0.81

6 11 0.045 5.1e+03 1.3 0.0 11 32 123 143 117 150 0.67

7 11 0.05 5.6e+03 1.2 0.0 8 25 164 181 163 183 0.84

8 11 0.019 2.1e+03 2.6 0.0 8 25 208 225 206 227 0.86

9 11 0.017 1.9e+03 2.7 0.0 9 26 231 248 229 259 0.67

10 11 0.056 6.3e+03 1.0 0.0 8 25 263 280 261 282 0.85

11 11 1 1.1e+05 -3.0 0.0 8 23 296 311 295 318 0.81

#	of	c-Evalue	i-Evalue	score	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	11	0.31	3.5e+04	-1.3	8	23	10	25	9	33	0.81
2	11	0.045	5.1e+03	1.3	11	32	24	44	18	51	0.67
3	11	0.05	5.6e+03	1.2	8	25	65	82	64	84	0.84
4	11	0.21	2.3e+04	-0.8	8	25	87	104	86	106	0.83
5	11	0.31	3.5e+04	-1.3	8	23	109	124	108	132	0.81
6	11	0.045	5.1e+03	1.3	11	32	123	143	117	150	0.67
7	11	0.05	5.6e+03	1.2	8	25	164	181	163	183	0.84
8	11	0.019	2.1e+03	2.6	8	25	208	225	206	227	0.86
9	11	0.017	1.9e+03	2.7	9	26	231	248	229	259	0.67
10	11	0.056	6.3e+03	1.0	8	25	263	280	261	282	0.85
11	11	1	1.1e+05	-3.0	8	23	296	311	295	318	0.81

Coding Sequence: atggatggcggcaagacgccgggcctacaacggttggatggcggcaagacactgGGCCTGCGGTGGATGGATGGCGGCATGACACCGGGCCTACAGTGGTTGGATGGTGGAAAGACACTGGGCCTGCGGtggatggatggcggcaagacaccgggcctacaacggttggatggcggcaataCACCGGGCCTGCAGCGGTTGGATGGTGGCAATACACCGGGCCTACggtggttggatggcggcaagacaccgggcctgcagcggttggatggcggcaagacactgGGCCTGCGGtggatggatggcggcaagacgccgggcctacaacggttggatggcggcaagacactgGGCCTGCGGTGGATGGATGGCGGCATGACACCGGGCCTACAGTGGTTGGATGGTGGAAAGACACTGGGCCTGCGGtggatggatggcggcaagacaccgggcctacaacggttggatggcggcaataCACCGGGCCTGCAGCGGTTGGATGGTGGCAATACACCGGGCCTACggtggttggatggcggcaagacaccgggcctgcagcggttggatggcggcaagacaccgggcctacaacagttggatggcggcaagacaccgggcctgcagcggttggatggcggcaagacaccgggcctgcagTGGTTGGATAGCGTAAAGACACCAGGCCTGCAgaggttggatggcggcaagacaccgggcctgcagtggttggatggcggcaagacaccgggcctgcagTGGTTGGATGGCGGCCAGACACCGGGCCTGCAgaggttggatggcggcaagacaccagGCCTGCAGTGGTTTAATGGCGGCAAGACACCAGGCCTGCAgaggttggatggcggcaagacactgGGCCTACAAcagttggatggcggcaagacaccgggcctgcagcAGTTGGATGttgcggcaagacaccgggcctgcggtggttggatggcggcaataCACCGGTCCTGCGGCGGTtga
Protein Sequence: MDGGKTPGLQRLDGGKTLGLRWMDGGMTPGLQWLDGGKTLGLRWMDGGKTPGLQRLDGGNTPGLQRLDGGNTPGLRWLDGGKTPGLQRLDGGKTLGLRWMDGGKTPGLQRLDGGKTLGLRWMDGGMTPGLQWLDGGKTLGLRWMDGGKTPGLQRLDGGNTPGLQRLDGGNTPGLRWLDGGKTPGLQRLDGGKTPGLQQLDGGKTPGLQRLDGGKTPGLQWLDSVKTPGLQRLDGGKTPGLQWLDGGKTPGLQWLDGGQTPGLQRLDGGKTPGLQWFNGGKTPGLQRLDGGKTLGLQQLDGGKTPGLQQLDVAARHRACGGWMAAIHRSCGG

Sequence clustering based on sequence similarity using MMseqs2