Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.0004 5.5 7.8 0.0 20 48 15 42 6 46 0.86

2 5 0.018 2.5e+02 2.5 0.0 22 47 73 98 65 104 0.81

3 5 0.014 2e+02 2.8 0.2 21 43 100 122 90 127 0.80

4 5 5.4e-05 0.74 10.6 0.4 21 46 128 153 120 156 0.88

5 5 0.00064 8.8 7.1 0.1 21 45 156 180 152 188 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.0004	5.5	7.8	0.0	20	48	15	42	6	46	0.86
2	5	0.018	2.5e+02	2.5	0.0	22	47	73	98	65	104	0.81
3	5	0.014	2e+02	2.8	0.2	21	43	100	122	90	127	0.80
4	5	5.4e-05	0.74	10.6	0.4	21	46	128	153	120	156	0.88
5	5	0.00064	8.8	7.1	0.1	21	45	156	180	152	188	0.89

Coding Sequence: TTCAATCAAATATCAAATCTAAAGGATCACATGCGAACCCACAACGGCGAGAAACCATTCCTGTGCTCAGTCTGCGGCAAGGGCTTCAATCAACTCGGCAATCTGCGACAGCACACTATCCGACATAGCGGTGTGAAAGCACATTTGTGCACGATATGCGGCACTGGCTTCGCTAGCAAAGGAGAACTCGGCGCGCATACTAGAAAACATACAgGCGCCAAACCATTCGTTTGCAACATCTGCAATCACGGCTTCACCACGTCGTCCTCGCTGACGAAGCACAAGCGCATCCATTCCGGCGAGAAGCCCTACGAGTGCGAGGTGTGCAAGATGCGCTTCTCGCGCTCCGGCATCCTCTCGCGCCACAAGCGCACGCACACCGGCGAGAAGCCGTACGCGTGTCCGCATTGCACGCGCGCGTTCGCGCAGAGCAACGATCTCGCCTCGCATCTGCGCATCCACACCGGCGAGCGGCCGTTCGTGTGCGACGTGTGCGGGCAGGCGTTTCGGCAGACGAGCGCGCTGAAGACGCACAAGAAGGTGCATCGCAATCGCGACGCGCCGCCGAAGACGGAGCGCGAGCCGGCCGGCATCGGGGTCGGCGTCGTCAAGAAGGAGATGGCCGTCGCCAACGGCGCTGTTTTATAA
Protein Sequence: FNQISNLKDHMRTHNGEKPFLCSVCGKGFNQLGNLRQHTIRHSGVKAHLCTICGTGFASKGELGAHTRKHTGAKPFVCNICNHGFTTSSSLTKHKRIHSGEKPYECEVCKMRFSRSGILSRHKRTHTGEKPYACPHCTRAFAQSNDLASHLRIHTGERPFVCDVCGQAFRQTSALKTHKKVHRNRDAPPKTEREPAGIGVGVVKKEMAVANGAVL

Sequence clustering based on sequence similarity using MMseqs2