Basic Information

Transcription Factor Domain

TF Family: zf-LITAF-like
Domain: zf-LITAF-like domain
PFAM: PF10601
TF Group: Zinc-Coordinating Group
Description: Members of this family display a conserved zinc ribbon structure [3] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS)[2]. The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 0.82 4e+02 1.0 0.0 23 47 16 42 8 50 0.54

2 3 0.00073 0.36 10.7 4.3 2 21 75 94 74 100 0.89

3 3 0.00062 0.3 11.0 2.7 51 70 98 117 95 117 0.87

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	0.82	4e+02	1.0	0.0	23	47	16	42	8	50	0.54
2	3	0.00073	0.36	10.7	4.3	2	21	75	94	74	100	0.89
3	3	0.00062	0.3	11.0	2.7	51	70	98	117	95	117	0.87

Coding Sequence: atgttttttgaaCATCCGAACACCGACCCACTGCAAAAccatcaaaacaaaaataaaactgaaaTGATCACATTCTTTCTCTCTGTTCTTCTCTTTGGAAGCGTTTTTGATCATGTTATACCTCTAATTTCTCTTCGCTTGTCTCAGTCTTCGTTTGGTTTTGAAACAGTTCAGTTCGACATGGCTCAGGATCCGCAAGCTCTTTACTTTGCCGTCGGTCCCGGTCCCAACGAGATCACCTGTCCTTATTGCAGGACCAAGGCTAAGACCCGTGTGGTGCGATCCTGGCTGCGTTGTTGCACCAAGAGACACCACTGTGGGGCCTGCGGGGAGTACCTGGGCGTATACCGCCGTCCACAACTGTAG
Protein Sequence: MFFEHPNTDPLQNHQNKNKTEMITFFLSVLLFGSVFDHVIPLISLRLSQSSFGFETVQFDMAQDPQALYFAVGPGPNEITCPYCRTKAKTRVVRSWLRCCTKRHHCGACGEYLGVYRRPQL

Sequence clustering based on sequence similarity using MMseqs2