g4762.t1
Basic Information
- Insect
- Drosophila pseudoobscura
- Gene Symbol
- -
- Assembly
- GCA_009870125.2
- Location
- CM020869.1:7746662-7747502[+]
Transcription Factor Domain
- TF Family
- zf-LITAF-like
- Domain
- zf-LITAF-like domain
- PFAM
- PF10601
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family display a conserved zinc ribbon structure [3] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS)[2]. The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 5.7e-28 7.7e-25 87.0 16.6 2 69 60 127 59 128 0.97
Sequence Information
- Coding Sequence
- ATGGACAGCAAGCAGCCTCCACCATACAGCGAGCAGAGCGGATTCACCCCGGCACAGACATATCAACCAGGTGGTCCCACACAGCCGCCGTTGTACCCACCCATGCCACAGCCGCCCCAGCAATCCACGGTGATCAttcagacgacgacgacctcCAATCTGGTGCCGATCGGCAGCGGCCCCACCCGCATTCGCTGCCCCTCCTGCCACGCCGAGGTGCTGACCACCGTGAAGAGCACCCCCTCGGGACGAACCCACTGCTGGGCGATGATCCTGTGCCTGTTCATCTGCTGGCCCTGCGTGTGCCTGCCCTACTGCATGGATTCCTGTCAGAACGCCAACCATTACTGCCCCAACTGCAGCGCATACATCGGCACCTTCGAGAACTAA
- Protein Sequence
- MDSKQPPPYSEQSGFTPAQTYQPGGPTQPPLYPPMPQPPQQSTVIIQTTTTSNLVPIGSGPTRIRCPSCHAEVLTTVKSTPSGRTHCWAMILCLFICWPCVCLPYCMDSCQNANHYCPNCSAYIGTFEN*
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01356513;
- 90% Identity
- iTF_00594210; iTF_00474179; iTF_00526243; iTF_00575235; iTF_00609539; iTF_00474885; iTF_00541445; iTF_00481222; iTF_00606728; iTF_00483337; iTF_00505067; iTF_00562124; iTF_00611724; iTF_00536430; iTF_00570062; iTF_00490447; iTF_00489041; iTF_00524785; iTF_00601425; iTF_00484786; iTF_00489746; iTF_00619506; iTF_00492627; iTF_00618003; iTF_00592756; iTF_00613172; iTF_00485525; iTF_00533463; iTF_00592055; iTF_00487672; iTF_00527706; iTF_00515260; iTF_00532028; iTF_00590620; iTF_00603740; iTF_00518109; iTF_00564317; iTF_00597022; iTF_00472031; iTF_00480543; iTF_00540031; iTF_00565759; iTF_00613855; iTF_00476289; iTF_00481894; iTF_00550608; iTF_00477691; iTF_00578945; iTF_00504354; iTF_00572263; iTF_00478380; iTF_00491885; iTF_00546318; iTF_00548462; iTF_00505775; iTF_00581935; iTF_00588529; iTF_00537170; iTF_00507987; iTF_00529939; iTF_00494772; iTF_00507989; iTF_00615254; iTF_00486970; iTF_00615866; iTF_00605980; iTF_00603005; iTF_00512384; iTF_00594912; iTF_00915884; iTF_00914980; iTF_00916850; iTF_00918709; iTF_00503661; iTF_00618821; iTF_00571571; iTF_00524087; iTF_00612479; iTF_00591368; iTF_00556234; iTF_00578186; iTF_00484108; iTF_00555502; iTF_00600721; iTF_00604502; iTF_00501467; iTF_00804850; iTF_00917709; iTF_00580339; iTF_00566455; iTF_00488380; iTF_00539324; iTF_00605239; iTF_00919550;
- 80% Identity
- iTF_00474179;