Basic Information

Insect: Drosophila pseudoobscura
Gene Symbol: HmgZ
Assembly: GCA_009870125.2
Location: CM020869.1:18902856-18903266[-]

Transcription Factor Domain

TF Family: HMG
Domain: HMG_box domain
PFAM: PF00505
TF Group: Other Alpha-Helix Group
Description: High mobility group (HMG) box domains are involved in binding DNA, and may be involved in protein-protein interactions as well. The structure of the HMG-box domain consists of three helices in an irregular array. HMG-box domains are found in one or more copies in HMG-box proteins, which form a large, diverse family involved in the regulation of DNA-dependent processes such as transcription, replication, and strand repair, all of which require the bending and unwinding of chromatin. Many of these proteins are regulators of gene expression. HMG-box proteins are found in a variety of eukaryotic organisms, and can be broadly divided into two groups, based on sequence-dependent and sequence-independent DNA recognition; the former usually contain one HMG-box motif, while the latter can contain multiple HMG-box motifs. HMG-box domains can be found in single or multiple copies in the following protein classes: HMG1 and HMG2 non-histone components of chromatin; SRY (sex determining region Y protein) involved in differential gonadogenesis; the SOX family of transcription factors [1]; sequence-specific LEF1 (lymphoid enhancer binding factor 1) and TCF-1 (T-cell factor 1) involved in regulation of organogenesis and thymocyte differentiation [2]; structure-specific recognition protein SSRP involved in transcription and replication; MTF1 mitochondrial transcription factor; nucleolar transcription factors UBF 1/2 (upstream binding factor) involved in transcription by RNA polymerase I; Abf2 yeast ARS-binding factor [3]; yeast transcription factors lxr1, Rox1, Nhp6b and Spp41; mating type proteins (MAT) involved in the sexual reproduction of fungi [4]; and the YABBY plant-specific transcription factors.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 2 9e-24 6.2e-21 74.8 2.2 1 69 8 74 8 74 0.99

2 2 7.9 5.5e+03 -2.0 0.4 20 34 87 101 83 109 0.63

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	2	9e-24	6.2e-21	74.8	2.2	1	69	8	74	8	74	0.99
2	2	7.9	5.5e+03	-2.0	0.4	20	34	87	101	83	109	0.63

Sequence Information

Coding Sequence: atGAGTGCAGCAGGAGATCGCCCGAAGCGTCCCCTGTCCGCCTACATGCTATGGCTGAACGAGACTCGTGAATCCATCAAGAAGGAGAATCCCGGCAGCAAGGTTACAGACATCGCCAAGCGCGGTGGTGAGCTCTGGCGCGGACTGAAGGACAAGACGGAATGGGAGCAGAAGGCCATCAAAATGAAGGAGGAGTACAATCGGGCGGTGAAGGAGTACGAGGCCAATGGCGGCACTGATTCCGGTGCGCCCAAGAAGCGAAAGAAGATGCCCGTCAAGCCCGTCAAGAAGATCAAGAAGAAGGAGTCCtccgaggaggatgaggaggacgaGAGCGAGTAG
Protein Sequence: MSAAGDRPKRPLSAYMLWLNETRESIKKENPGSKVTDIAKRGGELWRGLKDKTEWEQKAIKMKEEYNRAVKEYEANGGTDSGAPKKRKKMPVKPVKKIKKKESSEEDEEDESE*

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00338305; iTF_00487265; iTF_00489345; iTF_00543713; iTF_00568225; iTF_00805153; iTF_01324865; iTF_00529538; iTF_00536738; iTF_00541730; iTF_00565346; iTF_00581506; iTF_00832130; iTF_01325634; iTF_01327138; iTF_00062755; iTF_00492931; iTF_00514147; iTF_00559459; iTF_00606275; iTF_00477988; iTF_00482948; iTF_00499556; iTF_00516228; iTF_00524388; iTF_00548036; iTF_00551556; iTF_00598852; iTF_01321892; iTF_01556804; iTF_00061093; iTF_00478693; iTF_00480133; iTF_00548773; iTF_00574021; iTF_00619813; iTF_00890949; iTF_00473030; iTF_00485830; iTF_00528774; iTF_00613478; iTF_00915302; iTF_00481511; iTF_00531623; iTF_00587367; iTF_00588807; iTF_00616871; iTF_01356103; iTF_00258856; iTF_00474472; iTF_00492200; iTF_00560232; iTF_00598120; iTF_00616168; iTF_00804360; iTF_00918056; iTF_01114184; iTF_01549544; iTF_00508297; iTF_00525097; iTF_00533769; iTF_00542409; iTF_00553705; iTF_00592361; iTF_00605545; iTF_00914473; iTF_01550249; iTF_00257802; iTF_00486538; iTF_00498122; iTF_00514858; iTF_00558634; iTF_00562442; iTF_00573290; iTF_00577034; iTF_00596618; iTF_00615530; iTF_00972170; iTF_01022986; iTF_01321162; iTF_01363914; iTF_01552426; iTF_00335851; iTF_00511979; iTF_00518411; iTF_00530923; iTF_00537483; iTF_00563147; iTF_00566763; iTF_00584395; iTF_00916203; iTF_01486155; iTF_00495084; iTF_00521324; iTF_00536012; iTF_00589516; iTF_00595916; iTF_00614156; iTF_01195244; iTF_00045325; iTF_00339117; iTF_00366477; iTF_00497357; iTF_00527277; iTF_00538925; iTF_00564621; iTF_00919789; iTF_01181133; iTF_01553197; iTF_01554669; iTF_00501774; iTF_00511246; iTF_00517678; iTF_00539630; iTF_00544462; iTF_00545934; iTF_00561006; iTF_00578510; iTF_00579950; iTF_00585166; iTF_00604814; iTF_00612782; iTF_00891854; iTF_00472335; iTF_00485103; iTF_00493615; iTF_00510511; iTF_00515567; iTF_00549519; iTF_00550223; iTF_00553007; iTF_00588111; iTF_00617615; iTF_01319727; iTF_00506832; iTF_00509072; iTF_00535280; iTF_00593808; iTF_00803568; iTF_00805936; iTF_01200880; iTF_01414992; iTF_01553936; iTF_01559728; iTF_00512689; iTF_00522929; iTF_00533073; iTF_00540337; iTF_00582929; iTF_00585937; iTF_00593073; iTF_00603313; iTF_00541042; iTF_00552274; iTF_00554354; iTF_00556498; iTF_00567506; iTF_00582226; iTF_00595218; iTF_00919026; iTF_01324082; iTF_00337491; iTF_00475187; iTF_00504659; iTF_00519891; iTF_00528019; iTF_00543091; iTF_00550867; iTF_00568947; iTF_00609139; iTF_00619123; iTF_01470483; iTF_00476596; iTF_00526548; iTF_01323348; iTF_00495829; iTF_00579253; iTF_00594517; iTF_00597333; iTF_01327861; iTF_00473750; iTF_00494358; iTF_00513430; iTF_00532342; iTF_00534550; iTF_00538198; iTF_00607766; iTF_00890102; iTF_00967158; iTF_00470839; iTF_00500279; iTF_00591671; iTF_00611319; iTF_00797719; iTF_00917175; iTF_01551703; iTF_01555383; iTF_01558263; iTF_00503960; iTF_00569656; iTF_00746680; iTF_01322616; iTF_00519129; iTF_00520601; iTF_00545209; iTF_00586649; iTF_00488634; iTF_00496570; iTF_00572570; iTF_01320442; iTF_01550970; iTF_00477307; iTF_00479451; iTF_00491483; iTF_00498843; iTF_00509787; iTF_00525851; iTF_00530235; iTF_00557883; iTF_00571867; iTF_00576315; iTF_00608411; iTF_01165499; iTF_01548827; iTF_00061916; iTF_00482204; iTF_00484412; iTF_00610620; iTF_00614876; iTF_00748188; iTF_01319004; iTF_01557532; iTF_01559004; iTF_01570204; iTF_00475901; iTF_00490749; iTF_00505373; iTF_00547325; iTF_00574781; iTF_00602557; iTF_00979325; iTF_01326365; iTF_01570205; iTF_00336702; iTF_00471582; iTF_00487966; iTF_00490046; iTF_00522142; iTF_00561726; iTF_00570366; iTF_00599550; iTF_00607038; iTF_00750430; iTF_00802814; iTF_00901470; iTF_01556094; iTF_00502495; iTF_00507583; iTF_00546623; iTF_00590207; iTF_00601759; iTF_00609855; iTF_01055199; iTF_00259744; iTF_00480832; iTF_00506080; iTF_00516960; iTF_00563872; iTF_00566048; iTF_00575552; iTF_00583648; iTF_00601024; iTF_01132896; iTF_01404866; iTF_01563746; iTF_01357926; iTF_00189928; iTF_00303784; iTF_00191337; iTF_00091216; iTF_01562868; iTF_00081205; iTF_00190649; iTF_00192793; iTF_00082106; iTF_00192060; iTF_00992573; iTF_00082911; iTF_00193536; iTF_01505376; iTF_00571110; iTF_00503240; iTF_00555819; iTF_00612044; iTF_00483661; iTF_00523666; iTF_00577750; iTF_00501016; iTF_00590942; iTF_00600286; iTF_00618368; iTF_01189400; iTF_01045442; iTF_00251323; iTF_01195969; iTF_01426621; iTF_00749665; iTF_01378366; iTF_00624712; iTF_01051176;
90% Identity: iTF_00338305; iTF_00487265; iTF_00529538; iTF_00536738; iTF_00581506; iTF_00516228; iTF_00548036; iTF_00528774; iTF_00474472; iTF_00592361; iTF_00605545; iTF_00486538; iTF_00514858; iTF_00596618; iTF_00511979; iTF_00536012; iTF_00517678; iTF_00539630; iTF_00578510; iTF_00604814; iTF_00515567; iTF_00588111; iTF_00805936; iTF_00603313; iTF_00543091; iTF_00619123; iTF_00473750; iTF_00494358; iTF_00607766; iTF_00591671; iTF_00611319; iTF_01322616; iTF_01320442; iTF_00484412; iTF_00505373; iTF_00574781; iTF_00602557; iTF_01326365; iTF_00471582; iTF_00507583; iTF_00480832; iTF_00563872; iTF_00601024;
80% Identity: iTF_00487265;