Basic Information

Transcription Factor Domain

TF Family: Fork_head
Domain: Fork_head domain
PFAM: PF00250
TF Group: Helix-turn-helix
Description: The fork head domain is a conserved DNA-binding domain (also known as a winged helix) of about 100 amino-acid residues. Drosophila melanogaster fork head protein is a transcription factor that promotes terminal rather than segmental development, contains neither homeodomains nor zinc-fingers characteristic of other transcription factors [1]. Instead, it contains a distinct type of DNA-binding region, containing around 100 amino acids, which has since been identified in a number of transcription factors (including D. melanogaster FD1-5, mammalian HNF-3, human HTLF, Saccharomyces cerevisiae HCM1, etc.). This is referred to as the fork head domain but is also known as a 'winged helix' [1, 2, 3]. The fork head domain binds B-DNA as a monomer [2], but shows no similarity to previously identified DNA-binding motifs. Although the domain is found in several different transcription factors, a common function is their involvement in early developmental decisions of cell fates during embryogenesis [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 1.5e-37 1.6e-34 118.0 0.2 1 88 12 98 12 98 0.97

2 3 7.8 8.3e+03 -2.9 0.0 20 30 129 139 122 154 0.64

3 3 2.6 2.7e+03 -1.4 0.2 4 41 238 275 238 282 0.75

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	1.5e-37	1.6e-34	118.0	0.2	1	88	12	98	12	98	0.97
2	3	7.8	8.3e+03	-2.9	0.0	20	30	129	139	122	154	0.64
3	3	2.6	2.7e+03	-1.4	0.2	4	41	238	275	238	282	0.75

Coding Sequence: ATGCCTCGTCCATTGAAAATTACTTACGGCGACCAGAAGCCGCCCTACTCGTATATATCTTTAACAGCCATGGCCATTATACATTCCCCGCAAAGAATGCTGCCGCTCAGTGAAATATATCGATTTATTATAGACCAGTTTCCCTACTATAGGAGAAACACACAGCGCTGGCAAAACTCGTTGCGGCACAATTTGAGTTTCAACGATTGCTTCATTAAAGTTCCTCGCAATGTAACCAAATCGGGTAAAGGATCCTTCTGGACGCTTCATCCCAAGGCTTTCGATATGTTCGAGAACGGCAGTTTGTTGCGTAGACGTAAACGTTTTCGCGTAAAGCAGCTGGAAAAGGATCTTCTCAACTGCGAGATGGCAACTTTATCCTCGTATCGGAAAATGTTCACCCAGCAAATCTATGATCCGACACCTAATTGGGATTATATGAAAACGTTTAACGCCGACAATGAGCAAAACGGCGAACTTATCACTTCGCCCGCCTATCAAAATCCACAATTTCCTTTTCAACAACTACTAGTTCCCGCACATAAGTCGGGAGAACTAGACCAAAATACACCGACGCGGCCGAAACGTGCGTTTACCATTGAGAGTCTCATAGCTCCGGATACTATGGAAATAGCCGACAAGAAGTTCAATCACATTAATTATGGAATTCAAGAAGGCGTCGCTAGAAATAACGCCGGCGAGGAATTATTGCCATTTAGTTTTAATCAATTAGTTAGCCAGTATCAATTCTGTTCGCCAACGTTCACAAATATGTTGTACAACGTTCAGCACAGCATATCCGCTCATCATCAACAAATTCAGGAACAACTAATGGATTATTATAATGGTCCTCTACATGTATTTTGA
Protein Sequence: MPRPLKITYGDQKPPYSYISLTAMAIIHSPQRMLPLSEIYRFIIDQFPYYRRNTQRWQNSLRHNLSFNDCFIKVPRNVTKSGKGSFWTLHPKAFDMFENGSLLRRRKRFRVKQLEKDLLNCEMATLSSYRKMFTQQIYDPTPNWDYMKTFNADNEQNGELITSPAYQNPQFPFQQLLVPAHKSGELDQNTPTRPKRAFTIESLIAPDTMEIADKKFNHINYGIQEGVARNNAGEELLPFSFNQLVSQYQFCSPTFTNMLYNVQHSISAHHQQIQEQLMDYYNGPLHVF

Sequence clustering based on sequence similarity using MMseqs2